BLASTX nr result
ID: Ziziphus21_contig00047668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047668 (233 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG14935.1| Armadillo-like helical [Macrophomina phaseolina MS6] 105 1e-20 gb|KKY17914.1| hypothetical protein UCDDS831_g06229 [Diplodia se... 64 6e-08 >gb|EKG14935.1| Armadillo-like helical [Macrophomina phaseolina MS6] Length = 1867 Score = 105 bits (262), Expect = 1e-20 Identities = 53/58 (91%), Positives = 56/58 (96%) Frame = -1 Query: 233 LESLLFDARYEGLSEAMRVKRAQAMHALAKLPERGFARSLLVGRLGAEIEQERSPVVR 60 LE+LLFD RY+GLSEAMR+KRAQAMHALAKLPERGFARSLLVGRLG EIEQERSPVVR Sbjct: 1794 LEALLFDDRYDGLSEAMRIKRAQAMHALAKLPERGFARSLLVGRLGKEIEQERSPVVR 1851 >gb|KKY17914.1| hypothetical protein UCDDS831_g06229 [Diplodia seriata] Length = 1375 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = -1 Query: 233 LESLLFDARYEGLSEAMRVKRAQAMHALAKLPERG 129 L++LLF+ARY+GLSEAMRVKRAQA+HALAKLPERG Sbjct: 743 LDALLFNARYDGLSEAMRVKRAQAIHALAKLPERG 777