BLASTX nr result
ID: Ziziphus21_contig00047666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047666 (260 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKM28421.1| ATP citrate lyase [Aphis gossypii] 61 4e-07 ref|XP_008179483.1| PREDICTED: ATP citrate lyase isoform X1 [Acy... 61 4e-07 ref|NP_001153852.1| ATP citrate lyase [Acyrthosiphon pisum] 61 4e-07 ref|XP_014246746.1| PREDICTED: ATP-citrate synthase [Cimex lectu... 57 4e-06 ref|XP_001648848.1| AAEL004297-PA [Aedes aegypti] gi|108880117|g... 57 5e-06 >gb|AKM28421.1| ATP citrate lyase [Aphis gossypii] Length = 1092 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -3 Query: 132 MSAKAISEATGKGIINEHLKN-TAAAKCRYASVNEDTKWVDLKAD 1 MSAKAISEATGK IIN +L T+A KCR+ASVNE+TKW DL D Sbjct: 1 MSAKAISEATGKDIINRNLAPLTSAVKCRFASVNENTKWEDLVLD 45 >ref|XP_008179483.1| PREDICTED: ATP citrate lyase isoform X1 [Acyrthosiphon pisum] Length = 1092 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -3 Query: 132 MSAKAISEATGKGIINEHLKN-TAAAKCRYASVNEDTKWVDLKAD 1 MSAKAISEATGK IIN +L T+A KCR+ASVNE+TKW DL D Sbjct: 1 MSAKAISEATGKDIINRNLAPLTSAVKCRFASVNENTKWEDLVLD 45 >ref|NP_001153852.1| ATP citrate lyase [Acyrthosiphon pisum] Length = 1092 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -3 Query: 132 MSAKAISEATGKGIINEHLKN-TAAAKCRYASVNEDTKWVDLKAD 1 MSAKAISEATGK IIN +L T+A KCR+ASVNE+TKW DL D Sbjct: 1 MSAKAISEATGKDIINRNLAPLTSAVKCRFASVNENTKWEDLVLD 45 >ref|XP_014246746.1| PREDICTED: ATP-citrate synthase [Cimex lectularius] gi|939254104|ref|XP_014246747.1| PREDICTED: ATP-citrate synthase [Cimex lectularius] gi|939254106|ref|XP_014246748.1| PREDICTED: ATP-citrate synthase [Cimex lectularius] Length = 1081 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -3 Query: 132 MSAKAISEATGKGIINEHLKNTAAAKCRYASVNEDTKWVDL 10 MSAKAI EATGK ++N HL +++ AKCR+A+V E T W DL Sbjct: 1 MSAKAIREATGKDLLNRHLSSSSLAKCRFATVTESTNWSDL 41 >ref|XP_001648848.1| AAEL004297-PA [Aedes aegypti] gi|108880117|gb|EAT44342.1| AAEL004297-PA [Aedes aegypti] Length = 1127 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/45 (66%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = -3 Query: 132 MSAKAISEATGKGIINEHLKNT-AAAKCRYASVNEDTKWVDLKAD 1 MSAKAI EATGK IIN HL AAKCR+ASV+E T+W L AD Sbjct: 1 MSAKAIREATGKDIINRHLVGDHGAAKCRFASVDETTQWTQLVAD 45