BLASTX nr result
ID: Ziziphus21_contig00047626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047626 (276 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG09917.1| hypothetical protein MPH_13007 [Macrophomina phas... 138 2e-30 ref|XP_003837712.1| similar to C6 finger domain protein [Leptosp... 112 1e-22 ref|XP_007683695.1| hypothetical protein COCMIDRAFT_83594 [Bipol... 110 5e-22 ref|XP_014073978.1| hypothetical protein COCC4DRAFT_65796 [Bipol... 110 5e-22 ref|XP_007697844.1| hypothetical protein COCSADRAFT_188699 [Bipo... 110 5e-22 gb|KNG44328.1| hypothetical protein TW65_08679 [Stemphylium lyco... 109 7e-22 ref|XP_014558576.1| hypothetical protein COCVIDRAFT_94025 [Bipol... 109 7e-22 ref|XP_007708354.1| hypothetical protein COCCADRAFT_33401 [Bipol... 109 7e-22 gb|KIW05523.1| hypothetical protein PV09_03404 [Verruconis gallo... 108 2e-21 ref|XP_001932113.1| conserved hypothetical protein [Pyrenophora ... 106 6e-21 ref|XP_003305579.1| hypothetical protein PTT_18473 [Pyrenophora ... 105 1e-20 gb|EXV06251.1| Zn(2)-Cys(6) zinc finger domain protein [Metarhiz... 102 1e-19 gb|KOM24241.1| hypothetical protein XA68_7062 [Ophiocordyceps un... 101 3e-19 ref|XP_007830321.1| hypothetical protein PFICI_03549 [Pestalotio... 100 3e-19 ref|XP_007797419.1| putative negative acting factor protein [Eut... 100 3e-19 gb|KFH43755.1| Transcriptional regulatory protein-like protein [... 100 4e-19 emb|CCD43349.1| similar to transcription factor Cys6 [Botrytis c... 100 4e-19 gb|EQK99694.1| Zn(2)-C6 fungal-type DNA-binding domain protein [... 100 6e-19 gb|KND93080.1| White-opaque regulator 1 [Tolypocladium ophioglos... 100 7e-19 emb|CRK17917.1| hypothetical protein BN1723_011431 [Verticillium... 99 1e-18 >gb|EKG09917.1| hypothetical protein MPH_13007 [Macrophomina phaseolina MS6] Length = 630 Score = 138 bits (347), Expect = 2e-30 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT Sbjct: 1 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 60 Query: 10 RRA 2 +RA Sbjct: 61 KRA 63 >ref|XP_003837712.1| similar to C6 finger domain protein [Leptosphaeria maculans JN3] gi|312214275|emb|CBX94268.1| similar to C6 finger domain protein [Leptosphaeria maculans JN3] Length = 580 Score = 112 bits (280), Expect = 1e-22 Identities = 46/62 (74%), Positives = 56/62 (90%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVYTGKPSRGC CK+RRI+CDE RP+CGNC+KSGR CPG+PDEFDL+FR+EN A+AR+ Sbjct: 1 MVYTGKPSRGCGMCKSRRIKCDEKRPTCGNCKKSGRDCPGYPDEFDLVFRDENKAMARKA 60 Query: 10 RR 5 R+ Sbjct: 61 RK 62 >ref|XP_007683695.1| hypothetical protein COCMIDRAFT_83594 [Bipolaris oryzae ATCC 44560] gi|576936349|gb|EUC49845.1| hypothetical protein COCMIDRAFT_83594 [Bipolaris oryzae ATCC 44560] Length = 587 Score = 110 bits (274), Expect = 5e-22 Identities = 44/63 (69%), Positives = 56/63 (88%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVYTGKPSRGC CKTRRI+CDE RP+CGNC+KS R CPG+PD+FDL+FR+EN A+A++ Sbjct: 1 MVYTGKPSRGCGMCKTRRIKCDEKRPTCGNCKKSARVCPGYPDDFDLVFRDENKAMAKKA 60 Query: 10 RRA 2 R++ Sbjct: 61 RKS 63 >ref|XP_014073978.1| hypothetical protein COCC4DRAFT_65796 [Bipolaris maydis ATCC 48331] gi|452002595|gb|EMD95053.1| hypothetical protein COCHEDRAFT_1152891 [Bipolaris maydis C5] gi|477582966|gb|ENI00069.1| hypothetical protein COCC4DRAFT_65796 [Bipolaris maydis ATCC 48331] Length = 586 Score = 110 bits (274), Expect = 5e-22 Identities = 44/63 (69%), Positives = 56/63 (88%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVYTGKPSRGC CKTRRI+CDE RP+CGNC+KS R CPG+PD+FDL+FR+EN A+A++ Sbjct: 1 MVYTGKPSRGCGMCKTRRIKCDEKRPTCGNCKKSARVCPGYPDDFDLVFRDENKAMAKKA 60 Query: 10 RRA 2 R++ Sbjct: 61 RKS 63 >ref|XP_007697844.1| hypothetical protein COCSADRAFT_188699 [Bipolaris sorokiniana ND90Pr] gi|451853025|gb|EMD66319.1| hypothetical protein COCSADRAFT_188699 [Bipolaris sorokiniana ND90Pr] Length = 586 Score = 110 bits (274), Expect = 5e-22 Identities = 44/63 (69%), Positives = 56/63 (88%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVYTGKPSRGC CKTRRI+CDE RP+CGNC+KS R CPG+PD+FDL+FR+EN A+A++ Sbjct: 1 MVYTGKPSRGCGMCKTRRIKCDEKRPTCGNCKKSARVCPGYPDDFDLVFRDENKAMAKKA 60 Query: 10 RRA 2 R++ Sbjct: 61 RKS 63 >gb|KNG44328.1| hypothetical protein TW65_08679 [Stemphylium lycopersici] Length = 428 Score = 109 bits (273), Expect = 7e-22 Identities = 44/63 (69%), Positives = 56/63 (88%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVYTGKPSRGC CK+RRI+CDE RP+CGNC+KS R CPG+PD+FDL+FR+EN A+A+R Sbjct: 1 MVYTGKPSRGCGMCKSRRIKCDEKRPTCGNCKKSARVCPGYPDDFDLVFRDENKAMAKRA 60 Query: 10 RRA 2 R++ Sbjct: 61 RKS 63 >ref|XP_014558576.1| hypothetical protein COCVIDRAFT_94025 [Bipolaris victoriae FI3] gi|578491572|gb|EUN28978.1| hypothetical protein COCVIDRAFT_94025 [Bipolaris victoriae FI3] Length = 587 Score = 109 bits (273), Expect = 7e-22 Identities = 44/62 (70%), Positives = 55/62 (88%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVYTGKPSRGC CKTRRI+CDE RP+CGNC+KS R CPG+PD+FDL+FR+EN A+A++ Sbjct: 1 MVYTGKPSRGCGMCKTRRIKCDEKRPTCGNCKKSARVCPGYPDDFDLVFRDENKAMAKKA 60 Query: 10 RR 5 R+ Sbjct: 61 RK 62 >ref|XP_007708354.1| hypothetical protein COCCADRAFT_33401 [Bipolaris zeicola 26-R-13] gi|576923187|gb|EUC37307.1| hypothetical protein COCCADRAFT_33401 [Bipolaris zeicola 26-R-13] Length = 587 Score = 109 bits (273), Expect = 7e-22 Identities = 44/62 (70%), Positives = 55/62 (88%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVYTGKPSRGC CKTRRI+CDE RP+CGNC+KS R CPG+PD+FDL+FR+EN A+A++ Sbjct: 1 MVYTGKPSRGCGMCKTRRIKCDEKRPTCGNCKKSARVCPGYPDDFDLVFRDENKAMAKKA 60 Query: 10 RR 5 R+ Sbjct: 61 RK 62 >gb|KIW05523.1| hypothetical protein PV09_03404 [Verruconis gallopava] Length = 632 Score = 108 bits (270), Expect = 2e-21 Identities = 48/63 (76%), Positives = 52/63 (82%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVY GKPSRGCQ CKTRRI+CDE RP CG C KS R CPG+PDEFDLIFRNE AAV +R Sbjct: 1 MVYCGKPSRGCQNCKTRRIKCDEGRPCCGQCIKSKRECPGYPDEFDLIFRNETAAVKKRA 60 Query: 10 RRA 2 +RA Sbjct: 61 QRA 63 >ref|XP_001932113.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973719|gb|EDU41218.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 576 Score = 106 bits (265), Expect = 6e-21 Identities = 42/62 (67%), Positives = 55/62 (88%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVYTGKPSRGC CK+RRI+CDE RP+CGNC+KS R+CPG+PD+FDL+FR+EN A+ ++ Sbjct: 1 MVYTGKPSRGCGMCKSRRIKCDEKRPTCGNCKKSSRSCPGYPDDFDLVFRDENKAMLKKV 60 Query: 10 RR 5 R+ Sbjct: 61 RK 62 >ref|XP_003305579.1| hypothetical protein PTT_18473 [Pyrenophora teres f. teres 0-1] gi|311317321|gb|EFQ86324.1| hypothetical protein PTT_18473 [Pyrenophora teres f. teres 0-1] Length = 576 Score = 105 bits (263), Expect = 1e-20 Identities = 42/62 (67%), Positives = 54/62 (87%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVYTGKPSRGC CK+RRI+CDE RP+CGNC+KS R CPG+PD+FDL+FR+EN A+ ++ Sbjct: 1 MVYTGKPSRGCGMCKSRRIKCDEKRPTCGNCKKSSRPCPGYPDDFDLVFRDENKAMLKKV 60 Query: 10 RR 5 R+ Sbjct: 61 RK 62 >gb|EXV06251.1| Zn(2)-Cys(6) zinc finger domain protein [Metarhizium robertsii] Length = 616 Score = 102 bits (253), Expect = 1e-19 Identities = 43/63 (68%), Positives = 49/63 (77%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVY GKPSRGCQ C+TRRI+CDE +P+C C KS R CPG+ DEFDL+FRNE A RR Sbjct: 1 MVYCGKPSRGCQMCRTRRIKCDETKPTCNQCAKSRRICPGYKDEFDLVFRNETQATERRA 60 Query: 10 RRA 2 RRA Sbjct: 61 RRA 63 >gb|KOM24241.1| hypothetical protein XA68_7062 [Ophiocordyceps unilateralis] Length = 605 Score = 101 bits (251), Expect = 3e-19 Identities = 42/63 (66%), Positives = 49/63 (77%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVY GKPSRGCQ C+TRRI+CDE +P+C C KS R CPG+ DEFDL+FRNE A RR Sbjct: 1 MVYCGKPSRGCQMCRTRRIKCDETKPTCNQCAKSRRVCPGYKDEFDLVFRNETQATKRRA 60 Query: 10 RRA 2 R+A Sbjct: 61 RKA 63 >ref|XP_007830321.1| hypothetical protein PFICI_03549 [Pestalotiopsis fici W106-1] gi|573065922|gb|ETS85524.1| hypothetical protein PFICI_03549 [Pestalotiopsis fici W106-1] Length = 636 Score = 100 bits (250), Expect = 3e-19 Identities = 42/63 (66%), Positives = 49/63 (77%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVY GKPSRGCQ C+TRRI+CDE +P+C C KS R CPG+ DEFDL+FRNE A RR Sbjct: 1 MVYCGKPSRGCQMCRTRRIKCDETKPTCNQCAKSRRQCPGYKDEFDLVFRNETQATERRA 60 Query: 10 RRA 2 R+A Sbjct: 61 RKA 63 >ref|XP_007797419.1| putative negative acting factor protein [Eutypa lata UCREL1] gi|471561801|gb|EMR63477.1| putative negative acting factor protein [Eutypa lata UCREL1] Length = 618 Score = 100 bits (250), Expect = 3e-19 Identities = 42/63 (66%), Positives = 49/63 (77%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVY GKPSRGCQ C+TRRI+CDE +P+C C KS R CPG+ DEFDL+FRNE A RR Sbjct: 1 MVYCGKPSRGCQMCRTRRIKCDETKPTCNQCAKSRRQCPGYKDEFDLVFRNETQATERRA 60 Query: 10 RRA 2 R+A Sbjct: 61 RKA 63 >gb|KFH43755.1| Transcriptional regulatory protein-like protein [Acremonium chrysogenum ATCC 11550] Length = 614 Score = 100 bits (249), Expect = 4e-19 Identities = 42/63 (66%), Positives = 48/63 (76%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVY GKPSRGCQ C+TRRI+CDE +P C C KS R CPG+ DEFDL+FRNE A RR Sbjct: 1 MVYCGKPSRGCQMCRTRRIKCDETKPKCNQCAKSRRECPGYKDEFDLVFRNETQATERRA 60 Query: 10 RRA 2 R+A Sbjct: 61 RKA 63 >emb|CCD43349.1| similar to transcription factor Cys6 [Botrytis cinerea T4] Length = 711 Score = 100 bits (249), Expect = 4e-19 Identities = 41/63 (65%), Positives = 50/63 (79%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVY GKPSRGCQ C+TRRI+CDE +P+C C+KS R CPG+ D+FDL+FRNE A RR Sbjct: 1 MVYCGKPSRGCQMCRTRRIKCDETKPTCNQCQKSRRQCPGYKDDFDLVFRNETKATERRA 60 Query: 10 RRA 2 RR+ Sbjct: 61 RRS 63 >gb|EQK99694.1| Zn(2)-C6 fungal-type DNA-binding domain protein [Ophiocordyceps sinensis CO18] Length = 603 Score = 100 bits (248), Expect = 6e-19 Identities = 42/63 (66%), Positives = 49/63 (77%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVY GKPSRGCQ C+TRRI+CDE +P+C C KS RTCPG+ DEFDL+FRNE A R Sbjct: 1 MVYCGKPSRGCQMCRTRRIKCDETKPTCTQCAKSRRTCPGYKDEFDLVFRNETQATEMRA 60 Query: 10 RRA 2 R+A Sbjct: 61 RKA 63 >gb|KND93080.1| White-opaque regulator 1 [Tolypocladium ophioglossoides CBS 100239] Length = 606 Score = 99.8 bits (247), Expect = 7e-19 Identities = 41/63 (65%), Positives = 49/63 (77%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVY GKPSRGCQ C+TRRI+CDE +P+C C KS R CPG+ DEFDL+FRNE A +R Sbjct: 1 MVYCGKPSRGCQMCRTRRIKCDETKPTCNQCAKSRRICPGYKDEFDLVFRNETQATEKRA 60 Query: 10 RRA 2 R+A Sbjct: 61 RKA 63 >emb|CRK17917.1| hypothetical protein BN1723_011431 [Verticillium longisporum] Length = 628 Score = 99.4 bits (246), Expect = 1e-18 Identities = 41/63 (65%), Positives = 49/63 (77%) Frame = -3 Query: 190 MVYTGKPSRGCQTCKTRRIRCDEVRPSCGNCRKSGRTCPGFPDEFDLIFRNENAAVARRT 11 MVY GKPSRGCQ C+TRRI+CDE +P+C C KS R CPG+ DEFDL+FRNE A RR Sbjct: 1 MVYCGKPSRGCQMCRTRRIKCDETKPTCNQCTKSRRQCPGYKDEFDLVFRNETKATERRA 60 Query: 10 RRA 2 ++A Sbjct: 61 QKA 63