BLASTX nr result
ID: Ziziphus21_contig00047570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047570 (315 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007580511.1| putative ccch finger dna binding protein [Ne... 68 2e-09 ref|XP_007680880.1| hypothetical protein BAUCODRAFT_38691 [Baudo... 57 7e-06 >ref|XP_007580511.1| putative ccch finger dna binding protein [Neofusicoccum parvum UCRNP2] gi|485928370|gb|EOD52106.1| putative ccch finger dna binding protein [Neofusicoccum parvum UCRNP2] Length = 342 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 309 DEDDAFNLEALRRETEAARQAKEEERLAELHGGTATPV 196 D+DD +NLEALRRETEAARQAKEEERL EL+GGTATPV Sbjct: 304 DDDDPWNLEALRRETEAARQAKEEERLQELNGGTATPV 341 >ref|XP_007680880.1| hypothetical protein BAUCODRAFT_38691 [Baudoinia panamericana UAMH 10762] gi|449295557|gb|EMC91578.1| hypothetical protein BAUCODRAFT_38691 [Baudoinia panamericana UAMH 10762] Length = 362 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 309 DEDDAFNLEALRRETEAARQAKEEERLAELHGG 211 D+D A+NLEALRRETEAARQ KEEERLA+L+GG Sbjct: 313 DDDGAWNLEALRRETEAARQRKEEERLAQLNGG 345