BLASTX nr result
ID: Ziziphus21_contig00047511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047511 (292 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG16572.1| hypothetical protein MPH_06153 [Macrophomina phas... 99 1e-18 ref|XP_007589274.1| hypothetical protein UCRNP2_10043 [Neofusico... 84 3e-14 gb|KKY22317.1| hypothetical protein UCDDS831_g03482 [Diplodia se... 83 7e-14 >gb|EKG16572.1| hypothetical protein MPH_06153 [Macrophomina phaseolina MS6] Length = 351 Score = 99.0 bits (245), Expect = 1e-18 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = -1 Query: 277 MDTESKLAPAPVPVPINSGMMSGGSKIDAIEVDDNPSDDEDFALPTLPRNIRLTSRG 107 MDT+SKLAPAP+P+ IN G ++GGSKIDAIEVDDNPSDDEDF LPTLPRNIRLTSRG Sbjct: 296 MDTDSKLAPAPMPITIN-GAVNGGSKIDAIEVDDNPSDDEDFVLPTLPRNIRLTSRG 351 >ref|XP_007589274.1| hypothetical protein UCRNP2_10043 [Neofusicoccum parvum UCRNP2] gi|485915687|gb|EOD43253.1| hypothetical protein UCRNP2_10043 [Neofusicoccum parvum UCRNP2] Length = 346 Score = 84.3 bits (207), Expect = 3e-14 Identities = 43/61 (70%), Positives = 49/61 (80%) Frame = -1 Query: 289 SSGPMDTESKLAPAPVPVPINSGMMSGGSKIDAIEVDDNPSDDEDFALPTLPRNIRLTSR 110 S+ MDT++KL PA PVPINS + + SKID IEVDDN SDDEDF +PTLPRNIRLTSR Sbjct: 287 STESMDTDAKLLPAAAPVPINSSI-NISSKIDTIEVDDNVSDDEDFVMPTLPRNIRLTSR 345 Query: 109 G 107 G Sbjct: 346 G 346 >gb|KKY22317.1| hypothetical protein UCDDS831_g03482 [Diplodia seriata] Length = 349 Score = 83.2 bits (204), Expect = 7e-14 Identities = 44/60 (73%), Positives = 48/60 (80%), Gaps = 3/60 (5%) Frame = -1 Query: 277 MDTESKLAPAPVPVPINSGM---MSGGSKIDAIEVDDNPSDDEDFALPTLPRNIRLTSRG 107 MDT+SKL PA PV I SGM M+GG K D IEVDDNPSDDE+F +PTLPRNIRLTSRG Sbjct: 291 MDTDSKLMPAAAPVSI-SGMNTGMNGGLKTDTIEVDDNPSDDEEFLMPTLPRNIRLTSRG 349