BLASTX nr result
ID: Ziziphus21_contig00047499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047499 (279 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008720768.1| hypothetical protein HMPREF1541_08226 [Cyphe... 57 5e-06 >ref|XP_008720768.1| hypothetical protein HMPREF1541_08226 [Cyphellophora europaea CBS 101466] gi|568114614|gb|ETN37236.1| hypothetical protein HMPREF1541_08226 [Cyphellophora europaea CBS 101466] Length = 59 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/53 (49%), Positives = 39/53 (73%) Frame = -3 Query: 211 LEDLRAALRKAFPELSPEDFQTAAGDREKLAKIVSEKKGISSEDASKEVQAVW 53 +E RAALR F +++PE+F+ AG+R+ L K+V EK G+S E+A KEV A++ Sbjct: 4 VEKTRAALRAKFDKITPEEFKNTAGNRDALYKLVVEKHGLSEEEAKKEVDAIF 56