BLASTX nr result
ID: Ziziphus21_contig00047452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047452 (235 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007583327.1| putative oligopeptide transporter protein [N... 117 3e-24 >ref|XP_007583327.1| putative oligopeptide transporter protein [Neofusicoccum parvum UCRNP2] gi|485924346|gb|EOD49207.1| putative oligopeptide transporter protein [Neofusicoccum parvum UCRNP2] Length = 625 Score = 117 bits (293), Expect = 3e-24 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = -1 Query: 181 MPGDISDAHAGAKLDPALIDGSGDPKRSLSVHAHKTELPPVYDGTAVHQSEYLDHDLPIP 2 MPGDI+DA+A KLDPALIDGSGDPKRSLSVHAHKTELPP+YDG AVHQSEYLDHDLPIP Sbjct: 1 MPGDITDAYAADKLDPALIDGSGDPKRSLSVHAHKTELPPLYDGKAVHQSEYLDHDLPIP 60