BLASTX nr result
ID: Ziziphus21_contig00047431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047431 (289 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG10874.1| Helicase [Macrophomina phaseolina MS6] 91 4e-16 ref|XP_007582274.1| putative atp-dependent rna helicase protein ... 80 6e-13 >gb|EKG10874.1| Helicase [Macrophomina phaseolina MS6] Length = 615 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/61 (70%), Positives = 49/61 (80%) Frame = -1 Query: 247 MLRASSHLCPFCEVRALFPTRLSTSPKLQWQQTRLASQLQKRAKPARMELSARSPNPKLN 68 MLRASSHLCPFCE+RA +P R STS QWQQTR ASQLQKR+KPARM+LSA+ +P Sbjct: 1 MLRASSHLCPFCEIRAFYPLRPSTSISPQWQQTRFASQLQKRSKPARMQLSAKVAHPTPK 60 Query: 67 P 65 P Sbjct: 61 P 61 >ref|XP_007582274.1| putative atp-dependent rna helicase protein [Neofusicoccum parvum UCRNP2] gi|485925766|gb|EOD50264.1| putative atp-dependent rna helicase protein [Neofusicoccum parvum UCRNP2] Length = 619 Score = 80.1 bits (196), Expect = 6e-13 Identities = 39/61 (63%), Positives = 43/61 (70%) Frame = -1 Query: 247 MLRASSHLCPFCEVRALFPTRLSTSPKLQWQQTRLASQLQKRAKPARMELSARSPNPKLN 68 MLRASS LCPFCEVR LFP R + QWQQ R ASQLQKRAKP+RM+LS + K Sbjct: 1 MLRASSQLCPFCEVRTLFPVRTPKTIAPQWQQARFASQLQKRAKPSRMQLSPKVAQSKTK 60 Query: 67 P 65 P Sbjct: 61 P 61