BLASTX nr result
ID: Ziziphus21_contig00047355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047355 (408 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG12920.1| Zinc finger BED-type predicted protein [Macrophom... 71 4e-10 ref|XP_007584077.1| putative c2h2 finger domain-containing prote... 69 2e-09 gb|KKY14841.1| putative c2h2 finger domain-containing protein [D... 63 1e-07 >gb|EKG12920.1| Zinc finger BED-type predicted protein [Macrophomina phaseolina MS6] Length = 462 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 406 YAFNPAERKKDETVVGSLEPPVSGVAVGQDDVVDPSG 296 YAFNPAERKKDE VVG+LEPPV+GV +GQDDVVDPSG Sbjct: 426 YAFNPAERKKDEKVVGTLEPPVTGVVLGQDDVVDPSG 462 >ref|XP_007584077.1| putative c2h2 finger domain-containing protein [Neofusicoccum parvum UCRNP2] gi|485923250|gb|EOD48449.1| putative c2h2 finger domain-containing protein [Neofusicoccum parvum UCRNP2] Length = 471 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 406 YAFNPAERKKDETVVGSLEPPVSGVAVGQDDVVDPSG 296 YAFNPAER+KD+TVVGSLEPPV+GV GQDDVVD SG Sbjct: 435 YAFNPAERRKDDTVVGSLEPPVTGVVTGQDDVVDTSG 471 >gb|KKY14841.1| putative c2h2 finger domain-containing protein [Diplodia seriata] Length = 329 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 406 YAFNPAERKKDETVVGSLEPPVSGVAVGQDDVVDPSG 296 YAFNPA+R++DE VVGSL+PPV+GV GQDDV DPSG Sbjct: 293 YAFNPADRQQDEKVVGSLDPPVTGVVSGQDDVHDPSG 329