BLASTX nr result
ID: Ziziphus21_contig00047314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047314 (295 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG21239.1| Nucleic acid binding OB-fold tRNA/helicase-type [... 65 2e-08 >gb|EKG21239.1| Nucleic acid binding OB-fold tRNA/helicase-type [Macrophomina phaseolina MS6] Length = 616 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 295 VRYQVSSARELNFSAECASLIETLKQYQIGESDSLFVN 182 VRYQVSSA+ELN S ECA LIETLKQYQI +SDSLFVN Sbjct: 579 VRYQVSSAKELNLSFECARLIETLKQYQINDSDSLFVN 616