BLASTX nr result
ID: Ziziphus21_contig00047307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047307 (241 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007589274.1| hypothetical protein UCRNP2_10043 [Neofusico... 124 3e-26 gb|EKG16572.1| hypothetical protein MPH_06153 [Macrophomina phas... 122 8e-26 gb|KKY22317.1| hypothetical protein UCDDS831_g03482 [Diplodia se... 118 2e-24 gb|KNG51570.1| hypothetical protein TW65_91056 [Stemphylium lyco... 57 7e-06 >ref|XP_007589274.1| hypothetical protein UCRNP2_10043 [Neofusicoccum parvum UCRNP2] gi|485915687|gb|EOD43253.1| hypothetical protein UCRNP2_10043 [Neofusicoccum parvum UCRNP2] Length = 346 Score = 124 bits (311), Expect = 3e-26 Identities = 63/70 (90%), Positives = 65/70 (92%), Gaps = 2/70 (2%) Frame = -2 Query: 210 MSDSEKCFTFLRDNIPSWLEDLQRIAQKIEEKQDEIAKVPV--KTVKKTGSTETLKEGKE 37 MSDSEKCFTFLRDNIPSWLEDLQRIA KIEEKQDEIAKVPV K VKKTGSTETLK+GKE Sbjct: 1 MSDSEKCFTFLRDNIPSWLEDLQRIAHKIEEKQDEIAKVPVIQKVVKKTGSTETLKDGKE 60 Query: 36 ALLEQVGTDT 7 A+LEQ GTDT Sbjct: 61 AVLEQAGTDT 70 >gb|EKG16572.1| hypothetical protein MPH_06153 [Macrophomina phaseolina MS6] Length = 351 Score = 122 bits (307), Expect = 8e-26 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 2/71 (2%) Frame = -2 Query: 210 MSDSEKCFTFLRDNIPSWLEDLQRIAQKIEEKQDEIAKVPV--KTVKKTGSTETLKEGKE 37 MSDSEKCFTFLRDNIPSWLE+LQRIAQKIEEKQDEIAKVPV KT+KKTGSTETLKEGKE Sbjct: 1 MSDSEKCFTFLRDNIPSWLEELQRIAQKIEEKQDEIAKVPVVQKTLKKTGSTETLKEGKE 60 Query: 36 ALLEQVGTDTP 4 A+LEQ G++ P Sbjct: 61 AVLEQDGSNAP 71 >gb|KKY22317.1| hypothetical protein UCDDS831_g03482 [Diplodia seriata] Length = 349 Score = 118 bits (295), Expect = 2e-24 Identities = 61/68 (89%), Positives = 63/68 (92%), Gaps = 2/68 (2%) Frame = -2 Query: 210 MSDSEKCFTFLRDNIPSWLEDLQRIAQKIEEKQDEIAKVPV--KTVKKTGSTETLKEGKE 37 MSDSEKCFTFLRDNIP+WLEDLQRIA KIEEKQDEIAKVPV K VKKTGSTETLKEGKE Sbjct: 1 MSDSEKCFTFLRDNIPAWLEDLQRIATKIEEKQDEIAKVPVVQKVVKKTGSTETLKEGKE 60 Query: 36 ALLEQVGT 13 ALLEQ G+ Sbjct: 61 ALLEQDGS 68 >gb|KNG51570.1| hypothetical protein TW65_91056 [Stemphylium lycopersici] Length = 347 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/77 (37%), Positives = 49/77 (63%), Gaps = 9/77 (11%) Frame = -2 Query: 210 MSDSEKCFTFLRDNIPSWLEDLQRIAQKIEEKQDEIAKVPVKT----VKKTGSTETLKEG 43 MSD E+ FT+L+DNIP WL+D+ + +++ QD+I KVP+ ++T ST +++ Sbjct: 1 MSDIERSFTYLQDNIPQWLQDITALEERVTAMQDDITKVPISQSPFGKRRTDSTASIRPA 60 Query: 42 K-EALLEQV----GTDT 7 + +A++E V GT T Sbjct: 61 ELDAIVEDVTPSNGTST 77