BLASTX nr result
ID: Ziziphus21_contig00047302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047302 (289 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG18123.1| hypothetical protein MPH_04655 [Macrophomina phas... 65 3e-08 >gb|EKG18123.1| hypothetical protein MPH_04655 [Macrophomina phaseolina MS6] Length = 1022 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 287 PKGPPQGPPRITSPPSGSPTTAGFDASRRSS 195 PKGPPQGPPR+TSP +GSPTTAGFDASRRSS Sbjct: 728 PKGPPQGPPRVTSPAAGSPTTAGFDASRRSS 758