BLASTX nr result
ID: Ziziphus21_contig00047235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047235 (319 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007588680.1| hypothetical protein UCRNP2_9446 [Neofusicoc... 120 5e-25 >ref|XP_007588680.1| hypothetical protein UCRNP2_9446 [Neofusicoccum parvum UCRNP2] gi|485916526|gb|EOD43855.1| hypothetical protein UCRNP2_9446 [Neofusicoccum parvum UCRNP2] Length = 76 Score = 120 bits (300), Expect = 5e-25 Identities = 53/73 (72%), Positives = 60/73 (82%) Frame = -3 Query: 317 KAFTFLAISLLTVLGIASPIADRSSELTLEPRQCLVNGLFCGSASECCSGNCITVLCQNA 138 K FT LA++LLT ASPIAD S+ELTL+PRQCL NGLFCGS SECCSGNC+TVLC+N+ Sbjct: 2 KTFTLLALTLLTAFTAASPIADASAELTLKPRQCLANGLFCGSVSECCSGNCMTVLCENS 61 Query: 137 PEGPRCQPEGKSC 99 PEG RCQP G C Sbjct: 62 PEGKRCQPAGTQC 74