BLASTX nr result
ID: Ziziphus21_contig00047208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047208 (445 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007583024.1| putative helix-loop-helix dna binding protei... 76 9e-12 gb|EKG19626.1| hypothetical protein MPH_03102 [Macrophomina phas... 76 1e-11 gb|KKY25425.1| putative transcription factor bhlh [Diplodia seri... 72 2e-10 >ref|XP_007583024.1| putative helix-loop-helix dna binding protein [Neofusicoccum parvum UCRNP2] gi|485924758|gb|EOD49491.1| putative helix-loop-helix dna binding protein [Neofusicoccum parvum UCRNP2] Length = 305 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 445 QRAWTEVEIWKKACQNAGIVPEEFQNQGDKADRNGDS 335 QRAW E E+WKKACQNAGIVPEEFQNQGDK D+NGDS Sbjct: 269 QRAWAEAEVWKKACQNAGIVPEEFQNQGDKVDQNGDS 305 >gb|EKG19626.1| hypothetical protein MPH_03102 [Macrophomina phaseolina MS6] Length = 341 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -1 Query: 445 QRAWTEVEIWKKACQNAGIVPEEFQNQGDKADRNGDS 335 QRAW EVEIWKKACQNAGIVPEEFQNQ DKAD+NG+S Sbjct: 305 QRAWAEVEIWKKACQNAGIVPEEFQNQSDKADQNGES 341 >gb|KKY25425.1| putative transcription factor bhlh [Diplodia seriata] Length = 335 Score = 71.6 bits (174), Expect = 2e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 445 QRAWTEVEIWKKACQNAGIVPEEFQNQGDKADRNGD 338 QRAW E EIWKKACQNAGIVP+E+QNQGDKAD+N D Sbjct: 298 QRAWAEAEIWKKACQNAGIVPDEYQNQGDKADQNDD 333