BLASTX nr result
ID: Ziziphus21_contig00047178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047178 (263 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG16814.1| Vacuolar sorting protein 9 [Macrophomina phaseoli... 86 1e-14 >gb|EKG16814.1| Vacuolar sorting protein 9 [Macrophomina phaseolina MS6] Length = 779 Score = 85.9 bits (211), Expect = 1e-14 Identities = 47/87 (54%), Positives = 49/87 (56%) Frame = -3 Query: 261 SPRLEKANPMFGQPQAFPPRRSSLLPPDATPSSAQGSTETSPLSPVIQXXXXXXXXXXXX 82 SPRLEKANPMFGQPQ+FPPRRSSLLPPD S AQGSTE S LSP+IQ Sbjct: 194 SPRLEKANPMFGQPQSFPPRRSSLLPPDVNTSPAQGSTEASSLSPLIQSPLPPGISSNTS 253 Query: 81 XXXXXXXXXXXXXXXXXXXXSIYKPPP 1 SIYKPPP Sbjct: 254 FPSPAADQDPAPSPAPSHPHSIYKPPP 280