BLASTX nr result
ID: Ziziphus21_contig00047148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047148 (375 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG18324.1| hypothetical protein MPH_04406 [Macrophomina phas... 114 3e-23 gb|KKY16469.1| putative carbamoyl-phosphate synthase arginine-sp... 112 1e-22 ref|XP_007580467.1| putative carbamoyl-phosphate small subunit p... 106 8e-21 ref|XP_007779763.1| carbamoyl-phosphate synthase arginine-specif... 75 1e-11 gb|KIW02533.1| carbamoyl-phosphate synthase arginine-specific sm... 74 4e-11 ref|XP_001803201.1| hypothetical protein SNOG_12987 [Parastagono... 67 4e-09 ref|XP_008028859.1| glycoside hydrolase family 3 protein [Setosp... 67 7e-09 ref|XP_014551865.1| glycoside hydrolase family 3 protein [Bipola... 66 9e-09 ref|XP_007709295.1| glycoside hydrolase family 3 protein [Bipola... 66 9e-09 ref|XP_008088325.1| Class I glutamine amidotransferase-like prot... 66 1e-08 ref|XP_007685354.1| glycoside hydrolase family 3 protein [Bipola... 65 2e-08 gb|ESZ89760.1| putative Carbamoyl-phosphate synthase arginine-sp... 65 2e-08 ref|XP_014078558.1| glycoside hydrolase family 3 protein [Bipola... 65 2e-08 gb|EMD92965.1| hypothetical protein COCHEDRAFT_1029204 [Bipolari... 65 2e-08 ref|XP_007700786.1| glycoside hydrolase family 3 protein [Bipola... 65 2e-08 gb|KIN07722.1| hypothetical protein OIDMADRAFT_151504 [Oidiodend... 64 4e-08 dbj|GAM90372.1| hypothetical protein ANO11243_084150 [fungal sp.... 63 8e-08 gb|KEQ66344.1| small subunit of carbamoyl phosphate synthase [Au... 63 8e-08 emb|CCD45711.1| similar to carbamoyl-phosphate synthase arginine... 63 8e-08 gb|KNG48129.1| glycoside hydrolase family 3 protein [Stemphylium... 63 1e-07 >gb|EKG18324.1| hypothetical protein MPH_04406 [Macrophomina phaseolina MS6] Length = 471 Score = 114 bits (285), Expect = 3e-23 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEYNEKLGE 212 FDKYIDCV+AYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEYNEKLGE Sbjct: 404 FDKYIDCVRAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEYNEKLGE 457 >gb|KKY16469.1| putative carbamoyl-phosphate synthase arginine-specific small chain [Diplodia seriata] Length = 470 Score = 112 bits (280), Expect = 1e-22 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEYNEKLGEV 209 FDKY+DCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPG+PEYNE LG+V Sbjct: 403 FDKYVDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGLPEYNEHLGQV 457 >ref|XP_007580467.1| putative carbamoyl-phosphate small subunit protein [Neofusicoccum parvum UCRNP2] gi|485928274|gb|EOD52010.1| putative carbamoyl-phosphate small subunit protein [Neofusicoccum parvum UCRNP2] Length = 471 Score = 106 bits (264), Expect = 8e-21 Identities = 47/55 (85%), Positives = 54/55 (98%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEYNEKLGEV 209 FDKY+DCVKAYKDSQ+VFSAGK+NKPNPLLVDLLPKERVGVHPG+PE++E +GEV Sbjct: 404 FDKYVDCVKAYKDSQAVFSAGKNNKPNPLLVDLLPKERVGVHPGLPEWSEHVGEV 458 >ref|XP_007779763.1| carbamoyl-phosphate synthase arginine-specific small chain [Coniosporium apollinis CBS 100218] gi|494827496|gb|EON64446.1| carbamoyl-phosphate synthase arginine-specific small chain [Coniosporium apollinis CBS 100218] Length = 477 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEYNEKLG 215 FD YI+ VK YK+SQ+VFS K NKP+PLLVDLL KERVGVHPG+P++ G Sbjct: 408 FDAYIENVKKYKNSQAVFSPQKDNKPSPLLVDLLSKERVGVHPGLPDFRPGQG 460 >gb|KIW02533.1| carbamoyl-phosphate synthase arginine-specific small chain [Verruconis gallopava] Length = 473 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEY 230 FD YID V YK +QS+F+ + NKP+PLLVDLL KERVGVHPG+P+Y Sbjct: 403 FDAYIDSVSKYKRAQSIFAPNRDNKPSPLLVDLLSKERVGVHPGLPDY 450 >ref|XP_001803201.1| hypothetical protein SNOG_12987 [Parastagonospora nodorum SN15] gi|121934833|sp|Q0U5H7.1|CARA_PHANO RecName: Full=Carbamoyl-phosphate synthase arginine-specific small chain; Short=CPS-A; AltName: Full=Arginine-specific carbamoyl-phosphate synthetase, glutamine chain gi|111058667|gb|EAT79787.1| hypothetical protein SNOG_12987 [Parastagonospora nodorum SN15] Length = 476 Score = 67.4 bits (163), Expect = 4e-09 Identities = 34/48 (70%), Positives = 38/48 (79%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEY 230 FDKYI V+ YKD QS FS KSNKP+PLLVDLL KERVGVHP P++ Sbjct: 402 FDKYIQNVQRYKDHQSSFSE-KSNKPSPLLVDLLSKERVGVHPAQPDF 448 >ref|XP_008028859.1| glycoside hydrolase family 3 protein [Setosphaeria turcica Et28A] gi|482806151|gb|EOA83224.1| glycoside hydrolase family 3 protein [Setosphaeria turcica Et28A] Length = 1255 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEY 230 FDKYI+ V+ YKD Q+ FS +SNKP+PLLVDLL KERVGVHP P++ Sbjct: 1175 FDKYIENVQQYKDQQASFSQ-RSNKPSPLLVDLLAKERVGVHPDAPDF 1221 >ref|XP_014551865.1| glycoside hydrolase family 3 protein [Bipolaris victoriae FI3] gi|578484772|gb|EUN22286.1| glycoside hydrolase family 3 protein [Bipolaris victoriae FI3] Length = 1244 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEY 230 FDKYI+ V+ YKD Q+ FS +SNKP+PLLVDLL KERVGVHP P++ Sbjct: 1164 FDKYIENVQQYKDQQANFSQ-RSNKPSPLLVDLLAKERVGVHPDAPDF 1210 >ref|XP_007709295.1| glycoside hydrolase family 3 protein [Bipolaris zeicola 26-R-13] gi|576922235|gb|EUC36365.1| glycoside hydrolase family 3 protein [Bipolaris zeicola 26-R-13] Length = 1244 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEY 230 FDKYI+ V+ YKD Q+ FS +SNKP+PLLVDLL KERVGVHP P++ Sbjct: 1164 FDKYIENVQQYKDQQANFSQ-RSNKPSPLLVDLLAKERVGVHPDAPDF 1210 >ref|XP_008088325.1| Class I glutamine amidotransferase-like protein [Glarea lozoyensis ATCC 20868] gi|361125363|gb|EHK97409.1| putative Carbamoyl-phosphate synthase arginine-specific small chain [Glarea lozoyensis 74030] gi|512195399|gb|EPE24237.1| Class I glutamine amidotransferase-like protein [Glarea lozoyensis ATCC 20868] Length = 460 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEYN 227 FD YI+ VK YK++Q++ GK N+P+PLLVD+L KERVGVHP P N Sbjct: 404 FDMYIENVKRYKENQAIHPTGKDNRPSPLLVDILSKERVGVHPAQPAEN 452 >ref|XP_007685354.1| glycoside hydrolase family 3 protein [Bipolaris oryzae ATCC 44560] gi|576934642|gb|EUC48154.1| glycoside hydrolase family 3 protein [Bipolaris oryzae ATCC 44560] Length = 1244 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEY 230 FDKYI+ V+ YK+ Q+ FS +SNKP+PLLVDLL KERVGVHP P++ Sbjct: 1164 FDKYIENVQQYKEQQASFSQ-RSNKPSPLLVDLLAKERVGVHPDAPDF 1210 >gb|ESZ89760.1| putative Carbamoyl-phosphate synthase arginine-specific small chain [Sclerotinia borealis F-4157] Length = 457 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHP 245 FD YI+ V++YK +Q+V+ AGKSNKPNPLLVD+L KERVGV P Sbjct: 406 FDMYIENVQSYKKNQAVYPAGKSNKPNPLLVDILSKERVGVVP 448 >ref|XP_014078558.1| glycoside hydrolase family 3 protein [Bipolaris maydis ATCC 48331] gi|477587568|gb|ENI04649.1| glycoside hydrolase family 3 protein [Bipolaris maydis ATCC 48331] Length = 1243 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEY 230 FDKYI+ V+ YK+ Q+ FS +SNKP+PLLVDLL KERVGVHP P++ Sbjct: 1163 FDKYIENVQQYKEQQASFSQ-RSNKPSPLLVDLLAKERVGVHPDAPDF 1209 >gb|EMD92965.1| hypothetical protein COCHEDRAFT_1029204 [Bipolaris maydis C5] Length = 489 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEY 230 FDKYI+ V+ YK+ Q+ FS +SNKP+PLLVDLL KERVGVHP P++ Sbjct: 409 FDKYIENVQQYKEQQASFSQ-RSNKPSPLLVDLLAKERVGVHPDAPDF 455 >ref|XP_007700786.1| glycoside hydrolase family 3 protein [Bipolaris sorokiniana ND90Pr] gi|451850466|gb|EMD63768.1| glycoside hydrolase family 3 protein [Bipolaris sorokiniana ND90Pr] Length = 1244 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEY 230 FDKYI+ V+ YK+ Q+ FS +SNKP+PLLVDLL KERVGVHP P++ Sbjct: 1164 FDKYIENVQQYKEQQASFSQ-RSNKPSPLLVDLLAKERVGVHPDAPDF 1210 >gb|KIN07722.1| hypothetical protein OIDMADRAFT_151504 [Oidiodendron maius Zn] Length = 454 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHP 245 FD YID V+ YK++Q+VF+ GK N+P+PLLVD+L KERVGV P Sbjct: 397 FDMYIDNVQRYKENQAVFATGKDNRPSPLLVDILSKERVGVQP 439 >dbj|GAM90372.1| hypothetical protein ANO11243_084150 [fungal sp. No.11243] Length = 466 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEY 230 FD Y+ V+ YK +Q G+ N+P+PLLVDLL KERVGV PGIPEY Sbjct: 400 FDAYLKEVQQYKKTQVALQPGRVNRPSPLLVDLLAKERVGVRPGIPEY 447 >gb|KEQ66344.1| small subunit of carbamoyl phosphate synthase [Aureobasidium melanogenum CBS 110374] Length = 461 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEY 230 FD Y+D VK YK +Q+ SN+P+PLLVDLL KERVGV PG+P Y Sbjct: 406 FDAYVDSVKQYKKTQASLYPNMSNRPSPLLVDLLAKERVGVAPGVPLY 453 >emb|CCD45711.1| similar to carbamoyl-phosphate synthase arginine-specific small chain [Botrytis cinerea T4] Length = 455 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHP 245 FD YI+ V+ YK +Q+V+ AGK NKPNPLLVD+L KERVGV P Sbjct: 406 FDMYIENVQRYKKNQAVYPAGKDNKPNPLLVDILSKERVGVAP 448 >gb|KNG48129.1| glycoside hydrolase family 3 protein [Stemphylium lycopersici] Length = 489 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -3 Query: 373 FDKYIDCVKAYKDSQSVFSAGKSNKPNPLLVDLLPKERVGVHPGIPEY 230 FDKY++ V+ YK+ QS FS ++NKP+PLLVDLL K+RVGVHP P++ Sbjct: 409 FDKYMENVQQYKEHQSSFSE-RNNKPSPLLVDLLAKQRVGVHPAAPDF 455