BLASTX nr result
ID: Ziziphus21_contig00047099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047099 (434 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN12054.1| putative prophenoloxidase activating factor [Maco... 58 3e-06 >gb|ABN12054.1| putative prophenoloxidase activating factor [Maconellicoccus hirsutus] Length = 287 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 2/55 (3%) Frame = -2 Query: 160 ECGIRRQTGQNADS--TGNSTIDALFGEFPWMAAILRTSESSTDNTLICGGSILS 2 ECGIR+ G + D TG + + LFGEFPWM A+LR + SST+ TLICG S+LS Sbjct: 13 ECGIRK-AGDDFDLKITGEDS-ETLFGEFPWMVAVLRINASSTNGTLICGASLLS 65