BLASTX nr result
ID: Ziziphus21_contig00047073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047073 (216 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG20805.1| hypothetical protein MPH_01889 [Macrophomina phas... 110 5e-22 >gb|EKG20805.1| hypothetical protein MPH_01889 [Macrophomina phaseolina MS6] Length = 1045 Score = 110 bits (274), Expect = 5e-22 Identities = 49/70 (70%), Positives = 59/70 (84%) Frame = -3 Query: 214 RRDYMDRIHRLHLPLANTLFQTGRPSIMWNILCKVSEIDALTDGAPLEKPRFLYANKIND 35 RRD+ D IHRLHLPLANT+FQTG+ SIMWNIL +V+E + DG LE+PR LYA+K+ND Sbjct: 119 RRDFYDTIHRLHLPLANTIFQTGQTSIMWNILYRVNETEEYQDGVALEEPRSLYADKVND 178 Query: 34 VKYQRVTWPM 5 VKYQRVTWP+ Sbjct: 179 VKYQRVTWPL 188