BLASTX nr result
ID: Ziziphus21_contig00047048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00047048 (239 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY13847.1| putative ubiquinone biosynthesis protein [Diplodi... 100 6e-19 gb|EKG14555.1| Ubiquinone biosynthesis protein Coq7 [Macrophomin... 98 3e-18 ref|XP_007581092.1| putative ubiquinone biosynthesis protein coq... 97 5e-18 ref|XP_013430774.1| COQ7-domain-containing protein [Aureobasidiu... 94 3e-17 ref|XP_007782893.1| hypothetical protein W97_06944 [Coniosporium... 94 3e-17 gb|KEQ62216.1| ubiquinone biosynthesis protein CAT5 [Aureobasidi... 94 4e-17 gb|KIW07460.1| hypothetical protein PV09_01430 [Verruconis gallo... 92 2e-16 ref|XP_013341201.1| hypothetical protein AUEXF2481DRAFT_68319 [A... 92 2e-16 dbj|GAM85643.1| hypothetical protein ANO11243_036500 [fungal sp.... 91 3e-16 ref|XP_007925808.1| hypothetical protein MYCFIDRAFT_45964 [Pseud... 91 3e-16 gb|KJY01725.1| ubiquinone biosynthesis protein Coq7 [Zymoseptori... 91 4e-16 gb|KEQ85753.1| putative ubiquinone biosynthesis protein Coq7 [Au... 91 4e-16 ref|XP_008020108.1| hypothetical protein SETTUDRAFT_18619 [Setos... 90 8e-16 gb|EMF14128.1| catabolite repression protein CAT5 [Sphaerulina m... 89 1e-15 ref|XP_003296623.1| hypothetical protein PTT_06766 [Pyrenophora ... 89 1e-15 ref|XP_001932763.1| catabolite repression protein CAT5 [Pyrenoph... 89 1e-15 ref|XP_014560990.1| hypothetical protein COCVIDRAFT_87921 [Bipol... 89 2e-15 ref|XP_007687627.1| hypothetical protein COCMIDRAFT_36469 [Bipol... 89 2e-15 ref|XP_007708166.1| hypothetical protein COCCADRAFT_33258 [Bipol... 89 2e-15 ref|XP_014081129.1| hypothetical protein COCC4DRAFT_31233 [Bipol... 89 2e-15 >gb|KKY13847.1| putative ubiquinone biosynthesis protein [Diplodia seriata] Length = 255 Score = 100 bits (248), Expect = 6e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 238 QDLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 QDLRRIRDEELEHLDHAV+NDAKEARPYEVLTN+IRGGCRAAIWVSE+V Sbjct: 207 QDLRRIRDEELEHLDHAVENDAKEARPYEVLTNVIRGGCRAAIWVSERV 255 >gb|EKG14555.1| Ubiquinone biosynthesis protein Coq7 [Macrophomina phaseolina MS6] Length = 145 Score = 97.8 bits (242), Expect = 3e-18 Identities = 44/49 (89%), Positives = 49/49 (100%) Frame = -2 Query: 238 QDLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 QDLRRIRDEELEHLDHAV+NDAKEARPYE+LTN+IRGGCRAAIWV+E+V Sbjct: 97 QDLRRIRDEELEHLDHAVENDAKEARPYELLTNVIRGGCRAAIWVTERV 145 >ref|XP_007581092.1| putative ubiquinone biosynthesis protein coq7 protein [Neofusicoccum parvum UCRNP2] gi|485927435|gb|EOD51447.1| putative ubiquinone biosynthesis protein coq7 protein [Neofusicoccum parvum UCRNP2] Length = 222 Score = 97.1 bits (240), Expect = 5e-18 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = -2 Query: 238 QDLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 QDLRRIRDEELEHLDHAV NDAKEARPYEV TN+IRGGCRAAIWVSE+V Sbjct: 174 QDLRRIRDEELEHLDHAVANDAKEARPYEVFTNVIRGGCRAAIWVSERV 222 >ref|XP_013430774.1| COQ7-domain-containing protein [Aureobasidium namibiae CBS 147.97] gi|662518933|gb|KEQ76492.1| COQ7-domain-containing protein [Aureobasidium namibiae CBS 147.97] Length = 235 Score = 94.4 bits (233), Expect = 3e-17 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = -2 Query: 235 DLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 +LRRIRDEELEHLDHAV++DAKEARPYE+LTN+IRGGCRAAIWVSEKV Sbjct: 188 NLRRIRDEELEHLDHAVEHDAKEARPYELLTNVIRGGCRAAIWVSEKV 235 >ref|XP_007782893.1| hypothetical protein W97_06944 [Coniosporium apollinis CBS 100218] gi|494831067|gb|EON67576.1| hypothetical protein W97_06944 [Coniosporium apollinis CBS 100218] Length = 254 Score = 94.4 bits (233), Expect = 3e-17 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -2 Query: 238 QDLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 Q+LRRIRDEELEHLDHAV+NDAK ARPYE+LTN+IRGGCRAAIWVSE+V Sbjct: 206 QNLRRIRDEELEHLDHAVENDAKVARPYELLTNVIRGGCRAAIWVSERV 254 >gb|KEQ62216.1| ubiquinone biosynthesis protein CAT5 [Aureobasidium melanogenum CBS 110374] Length = 247 Score = 94.0 bits (232), Expect = 4e-17 Identities = 42/48 (87%), Positives = 48/48 (100%) Frame = -2 Query: 235 DLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 +LRRIRDEELEHLDHAV++DAKEARPYE+LTN+IRGGCRAAIW+SEKV Sbjct: 200 NLRRIRDEELEHLDHAVEHDAKEARPYELLTNVIRGGCRAAIWISEKV 247 >gb|KIW07460.1| hypothetical protein PV09_01430 [Verruconis gallopava] Length = 260 Score = 91.7 bits (226), Expect = 2e-16 Identities = 39/49 (79%), Positives = 47/49 (95%) Frame = -2 Query: 238 QDLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 Q LRRIRDEELEHLDHAV+NDAK+A+PYE+LTN+IRGGCR AIW+SE++ Sbjct: 212 QTLRRIRDEELEHLDHAVENDAKQAKPYELLTNVIRGGCRTAIWISERI 260 >ref|XP_013341201.1| hypothetical protein AUEXF2481DRAFT_68319 [Aureobasidium subglaciale EXF-2481] gi|662535350|gb|KEQ92667.1| hypothetical protein AUEXF2481DRAFT_68319 [Aureobasidium subglaciale EXF-2481] Length = 235 Score = 91.7 bits (226), Expect = 2e-16 Identities = 41/48 (85%), Positives = 47/48 (97%) Frame = -2 Query: 235 DLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 +LRRIRDEELEHLDHAV++DAK+ARPYE+LTN+IRGGCRAAIW SEKV Sbjct: 188 NLRRIRDEELEHLDHAVEHDAKQARPYELLTNVIRGGCRAAIWASEKV 235 >dbj|GAM85643.1| hypothetical protein ANO11243_036500 [fungal sp. No.11243] Length = 256 Score = 91.3 bits (225), Expect = 3e-16 Identities = 39/49 (79%), Positives = 48/49 (97%) Frame = -2 Query: 238 QDLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 +D+RRIRDEELEHLDHAV++DAKEA+PYE+LTNIIRGGCR AIW++EK+ Sbjct: 208 KDIRRIRDEELEHLDHAVEHDAKEAQPYELLTNIIRGGCRTAIWITEKI 256 >ref|XP_007925808.1| hypothetical protein MYCFIDRAFT_45964 [Pseudocercospora fijiensis CIRAD86] gi|452983430|gb|EME83188.1| hypothetical protein MYCFIDRAFT_45964 [Pseudocercospora fijiensis CIRAD86] Length = 248 Score = 91.3 bits (225), Expect = 3e-16 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -2 Query: 238 QDLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 +D+RRIRDEELEHLDHAV+NDAKEA PYE+LT +IRGGCR AIW+SEK+ Sbjct: 200 KDIRRIRDEELEHLDHAVENDAKEANPYELLTGVIRGGCRGAIWISEKI 248 >gb|KJY01725.1| ubiquinone biosynthesis protein Coq7 [Zymoseptoria brevis] Length = 245 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -2 Query: 238 QDLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 +D+RRIRDEELEHLDHAV+NDAKEA+PYE+LT +IR GCR AIWVSEKV Sbjct: 197 KDIRRIRDEELEHLDHAVENDAKEAKPYELLTGVIRAGCRGAIWVSEKV 245 >gb|KEQ85753.1| putative ubiquinone biosynthesis protein Coq7 [Aureobasidium pullulans EXF-150] Length = 233 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/48 (85%), Positives = 48/48 (100%) Frame = -2 Query: 235 DLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 +LRRIRDEELEHLDHAV++DAKEARPYE+LTN+IRGGCRAAI+VSEK+ Sbjct: 186 NLRRIRDEELEHLDHAVEHDAKEARPYELLTNVIRGGCRAAIYVSEKI 233 >ref|XP_008020108.1| hypothetical protein SETTUDRAFT_18619 [Setosphaeria turcica Et28A] gi|482815285|gb|EOA91960.1| hypothetical protein SETTUDRAFT_18619 [Setosphaeria turcica Et28A] Length = 253 Score = 89.7 bits (221), Expect = 8e-16 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -2 Query: 235 DLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 +LRRIRDEELEHLDHAV+NDAK ARPYE+LT +IRGGCR AIWVSE+V Sbjct: 206 ELRRIRDEELEHLDHAVENDAKSARPYELLTEVIRGGCRGAIWVSERV 253 >gb|EMF14128.1| catabolite repression protein CAT5 [Sphaerulina musiva SO2202] Length = 247 Score = 89.4 bits (220), Expect = 1e-15 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = -2 Query: 235 DLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 D+RRIRDEELEHLDHAV+NDAKEA PYE+LT +IRGGCR AIW++EKV Sbjct: 200 DIRRIRDEELEHLDHAVENDAKEANPYELLTGVIRGGCRGAIWLTEKV 247 >ref|XP_003296623.1| hypothetical protein PTT_06766 [Pyrenophora teres f. teres 0-1] gi|311331184|gb|EFQ95315.1| hypothetical protein PTT_06766 [Pyrenophora teres f. teres 0-1] Length = 266 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = -2 Query: 235 DLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 DLRRIRDEELEHLDHAV+NDAK A+PY++LT +IRGGCR AIWVSE+V Sbjct: 219 DLRRIRDEELEHLDHAVENDAKSAKPYDLLTEVIRGGCRGAIWVSERV 266 >ref|XP_001932763.1| catabolite repression protein CAT5 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978327|gb|EDU44953.1| catabolite repression protein CAT5 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 265 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = -2 Query: 235 DLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 DLRRIRDEELEHLDHAV+NDAK A+PY++LT +IRGGCR AIWVSE+V Sbjct: 218 DLRRIRDEELEHLDHAVENDAKSAKPYDLLTEVIRGGCRGAIWVSERV 265 >ref|XP_014560990.1| hypothetical protein COCVIDRAFT_87921 [Bipolaris victoriae FI3] gi|578494005|gb|EUN31394.1| hypothetical protein COCVIDRAFT_87921 [Bipolaris victoriae FI3] Length = 252 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = -2 Query: 235 DLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 +LRRIRDEELEHLDHAV+NDAK A+PYE+LT +IRGGCR AIWVSE+V Sbjct: 205 ELRRIRDEELEHLDHAVENDAKNAKPYELLTEVIRGGCRGAIWVSERV 252 >ref|XP_007687627.1| hypothetical protein COCMIDRAFT_36469 [Bipolaris oryzae ATCC 44560] gi|576932324|gb|EUC45868.1| hypothetical protein COCMIDRAFT_36469 [Bipolaris oryzae ATCC 44560] Length = 252 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = -2 Query: 235 DLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 +LRRIRDEELEHLDHAV+NDAK A+PYE+LT +IRGGCR AIWVSE+V Sbjct: 205 ELRRIRDEELEHLDHAVENDAKNAKPYELLTEVIRGGCRGAIWVSERV 252 >ref|XP_007708166.1| hypothetical protein COCCADRAFT_33258 [Bipolaris zeicola 26-R-13] gi|576923414|gb|EUC37532.1| hypothetical protein COCCADRAFT_33258 [Bipolaris zeicola 26-R-13] Length = 252 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = -2 Query: 235 DLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 +LRRIRDEELEHLDHAV+NDAK A+PYE+LT +IRGGCR AIWVSE+V Sbjct: 205 ELRRIRDEELEHLDHAVENDAKNAKPYELLTEVIRGGCRGAIWVSERV 252 >ref|XP_014081129.1| hypothetical protein COCC4DRAFT_31233 [Bipolaris maydis ATCC 48331] gi|452000872|gb|EMD93332.1| hypothetical protein COCHEDRAFT_1020470 [Bipolaris maydis C5] gi|477590145|gb|ENI07220.1| hypothetical protein COCC4DRAFT_31233 [Bipolaris maydis ATCC 48331] Length = 252 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = -2 Query: 235 DLRRIRDEELEHLDHAVDNDAKEARPYEVLTNIIRGGCRAAIWVSEKV 92 +LRRIRDEELEHLDHAV+NDAK A+PYE+LT +IRGGCR AIWVSE+V Sbjct: 205 ELRRIRDEELEHLDHAVENDAKNAKPYELLTEVIRGGCRGAIWVSERV 252