BLASTX nr result
ID: Ziziphus21_contig00046959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046959 (292 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG10449.1| Zinc finger CCCH-type protein [Macrophomina phase... 95 2e-17 ref|XP_007587481.1| putative zinc finger ccch-type protein [Neof... 87 6e-15 ref|XP_008720304.1| hypothetical protein HMPREF1541_07759 [Cyphe... 62 2e-07 gb|KIV96376.1| hypothetical protein PV10_00257 [Exophiala mesoph... 58 3e-06 gb|KEQ82799.1| hypothetical protein M438DRAFT_398350 [Aureobasid... 57 5e-06 gb|KEQ67052.1| hypothetical protein M437DRAFT_61505 [Aureobasidi... 57 7e-06 gb|KJR83575.1| CCCH zinc finger domain-containing protein [Sporo... 56 9e-06 gb|KIH93866.1| hypothetical protein SPBR_05700 [Sporothrix brasi... 56 9e-06 >gb|EKG10449.1| Zinc finger CCCH-type protein [Macrophomina phaseolina MS6] Length = 590 Score = 95.1 bits (235), Expect = 2e-17 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = -1 Query: 145 MAPCKFYLQGNCKFGDRCKFDHPGAHTQNRGIQQNQNRFAALGNANTG 2 MAPCKFYLQGNCKFGDRCKFDHPGAH NRG QQNQNRF+AL NANTG Sbjct: 1 MAPCKFYLQGNCKFGDRCKFDHPGAH--NRGNQQNQNRFSALSNANTG 46 >ref|XP_007587481.1| putative zinc finger ccch-type protein [Neofusicoccum parvum UCRNP2] gi|485918376|gb|EOD45050.1| putative zinc finger ccch-type protein [Neofusicoccum parvum UCRNP2] Length = 74 Score = 86.7 bits (213), Expect = 6e-15 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 4/56 (7%) Frame = -1 Query: 157 PRYA-MAPCKFYLQGNCKFGDRCKFDHPGAHTQNRGI---QQNQNRFAALGNANTG 2 PR A MAPCK++LQGNCKFGDRC+FDHPGA+ QNR Q QNRFAAL NANTG Sbjct: 3 PRQADMAPCKYFLQGNCKFGDRCRFDHPGAYNQNRSSNQQNQGQNRFAALNNANTG 58 >ref|XP_008720304.1| hypothetical protein HMPREF1541_07759 [Cyphellophora europaea CBS 101466] gi|568115514|gb|ETN38135.1| hypothetical protein HMPREF1541_07759 [Cyphellophora europaea CBS 101466] Length = 670 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -1 Query: 145 MAPCKFYLQGNCKFGDRCKFDHPGAHTQNRGIQQNQNRFAALGNANTG 2 M CKF+LQGNC++G C+FDHPG+ + G Q+QNRF L + N+G Sbjct: 1 MVTCKFFLQGNCRYGQNCRFDHPGSGSSG-GQSQSQNRFGPLASGNSG 47 >gb|KIV96376.1| hypothetical protein PV10_00257 [Exophiala mesophila] Length = 715 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/48 (54%), Positives = 30/48 (62%) Frame = -1 Query: 145 MAPCKFYLQGNCKFGDRCKFDHPGAHTQNRGIQQNQNRFAALGNANTG 2 M CKF+ QGNCKFGD C+F+HPG+ NR N NRF AL G Sbjct: 1 MVVCKFWQQGNCKFGDSCRFEHPGS---NRSGGSNSNRFGALATGGGG 45 >gb|KEQ82799.1| hypothetical protein M438DRAFT_398350 [Aureobasidium pullulans EXF-150] Length = 659 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = -1 Query: 136 CKFYLQGNCKFGDRCKFDHPGAHTQNRGIQQNQNRFAALGNANTG 2 C FY QG CKFGD CKF+HPGA+ Q NRF ALGN + G Sbjct: 19 CSFYQQGRCKFGDNCKFEHPGANKP----QDTGNRFQALGNNSFG 59 >gb|KEQ67052.1| hypothetical protein M437DRAFT_61505 [Aureobasidium melanogenum CBS 110374] Length = 664 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/41 (60%), Positives = 28/41 (68%) Frame = -1 Query: 136 CKFYLQGNCKFGDRCKFDHPGAHTQNRGIQQNQNRFAALGN 14 C FY QG CKFGD CKF+HPGA+ Q + NRF ALGN Sbjct: 20 CSFYQQGRCKFGDNCKFEHPGANRS----QDSGNRFQALGN 56 >gb|KJR83575.1| CCCH zinc finger domain-containing protein [Sporothrix schenckii 1099-18] Length = 666 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/48 (50%), Positives = 31/48 (64%) Frame = -1 Query: 145 MAPCKFYLQGNCKFGDRCKFDHPGAHTQNRGIQQNQNRFAALGNANTG 2 M CKF+LQGNC+FG+ C+++HP QNQNRF A G +TG Sbjct: 1 MVVCKFWLQGNCRFGNNCRYEHP---------PQNQNRFGAFGQPSTG 39 >gb|KIH93866.1| hypothetical protein SPBR_05700 [Sporothrix brasiliensis 5110] Length = 661 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/48 (50%), Positives = 31/48 (64%) Frame = -1 Query: 145 MAPCKFYLQGNCKFGDRCKFDHPGAHTQNRGIQQNQNRFAALGNANTG 2 M CKF+LQGNC+FG+ C+++HP QNQNRF A G +TG Sbjct: 1 MVVCKFWLQGNCRFGNNCRYEHP---------PQNQNRFGAFGQPSTG 39