BLASTX nr result
ID: Ziziphus21_contig00046947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046947 (259 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007688771.1| hypothetical protein COCMIDRAFT_6026 [Bipola... 89 1e-15 ref|XP_007715525.1| hypothetical protein COCCADRAFT_7744 [Bipola... 89 1e-15 ref|XP_008031423.1| hypothetical protein SETTUDRAFT_166233 [Seto... 89 1e-15 ref|XP_014079882.1| hypothetical protein COCC4DRAFT_194629 [Bipo... 89 1e-15 ref|XP_007702324.1| hypothetical protein COCSADRAFT_226390 [Bipo... 89 1e-15 gb|EKG14615.1| hypothetical protein MPH_08195 [Macrophomina phas... 88 2e-15 gb|KKY16769.1| putative swib mdm2 domain-containing protein [Dip... 88 3e-15 gb|KNG49136.1| secretion pathway protein sls2 rcy1 [Stemphylium ... 87 5e-15 ref|XP_003305343.1| hypothetical protein PTT_18158 [Pyrenophora ... 87 5e-15 ref|XP_001933158.1| conserved hypothetical protein [Pyrenophora ... 87 5e-15 ref|XP_001794015.1| hypothetical protein SNOG_03451 [Parastagono... 86 1e-14 ref|XP_007782008.1| hypothetical protein W97_05937 [Coniosporium... 85 2e-14 dbj|GAM90671.1| hypothetical protein ANO11243_087160 [fungal sp.... 85 2e-14 ref|XP_007584898.1| putative swib mdm2 domain protein [Neofusico... 85 2e-14 ref|XP_003833662.1| similar to SWIB/MDM2 domain-containing prote... 84 3e-14 dbj|GAQ11582.1| upstream activation factor subunit spp27 [Asperg... 84 5e-14 ref|XP_001265449.1| SWIB/MDM2 domain protein [Neosartorya fische... 84 5e-14 ref|XP_001269940.1| SWIB/MDM2 domain protein [Aspergillus clavat... 84 5e-14 dbj|GAD93942.1| SWIB/MDM2 domain protein [Byssochlamys spectabil... 83 9e-14 ref|XP_001389048.2| SWIB/MDM2 domain protein [Aspergillus niger ... 82 2e-13 >ref|XP_007688771.1| hypothetical protein COCMIDRAFT_6026 [Bipolaris oryzae ATCC 44560] gi|576931125|gb|EUC44692.1| hypothetical protein COCMIDRAFT_6026 [Bipolaris oryzae ATCC 44560] Length = 283 Score = 89.0 bits (219), Expect = 1e-15 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDPNDKRQIRCD+AMRAVFKQDRVHMFTMNKILNQNLYA DE Sbjct: 238 LQDPNDKRQIRCDDAMRAVFKQDRVHMFTMNKILNQNLYAVDE 280 >ref|XP_007715525.1| hypothetical protein COCCADRAFT_7744 [Bipolaris zeicola 26-R-13] gi|953424807|ref|XP_014554475.1| hypothetical protein COCVIDRAFT_28516 [Bipolaris victoriae FI3] gi|576915893|gb|EUC30173.1| hypothetical protein COCCADRAFT_7744 [Bipolaris zeicola 26-R-13] gi|578487443|gb|EUN24901.1| hypothetical protein COCVIDRAFT_28516 [Bipolaris victoriae FI3] Length = 283 Score = 89.0 bits (219), Expect = 1e-15 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDPNDKRQIRCD+AMRAVFKQDRVHMFTMNKILNQNLYA DE Sbjct: 238 LQDPNDKRQIRCDDAMRAVFKQDRVHMFTMNKILNQNLYAVDE 280 >ref|XP_008031423.1| hypothetical protein SETTUDRAFT_166233 [Setosphaeria turcica Et28A] gi|482803683|gb|EOA80808.1| hypothetical protein SETTUDRAFT_166233 [Setosphaeria turcica Et28A] Length = 280 Score = 89.0 bits (219), Expect = 1e-15 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDPNDKRQIRCD+AMRAVFKQDRVHMFTMNKILNQNLYA DE Sbjct: 235 LQDPNDKRQIRCDDAMRAVFKQDRVHMFTMNKILNQNLYAVDE 277 >ref|XP_014079882.1| hypothetical protein COCC4DRAFT_194629 [Bipolaris maydis ATCC 48331] gi|451998479|gb|EMD90943.1| hypothetical protein COCHEDRAFT_1176551 [Bipolaris maydis C5] gi|477588895|gb|ENI05973.1| hypothetical protein COCC4DRAFT_194629 [Bipolaris maydis ATCC 48331] Length = 283 Score = 89.0 bits (219), Expect = 1e-15 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDPNDKRQIRCD+AMRAVFKQDRVHMFTMNKILNQNLYA DE Sbjct: 238 LQDPNDKRQIRCDDAMRAVFKQDRVHMFTMNKILNQNLYAVDE 280 >ref|XP_007702324.1| hypothetical protein COCSADRAFT_226390 [Bipolaris sorokiniana ND90Pr] gi|451848665|gb|EMD61970.1| hypothetical protein COCSADRAFT_226390 [Bipolaris sorokiniana ND90Pr] Length = 283 Score = 89.0 bits (219), Expect = 1e-15 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDPNDKRQIRCD+AMRAVFKQDRVHMFTMNKILNQNLYA DE Sbjct: 238 LQDPNDKRQIRCDDAMRAVFKQDRVHMFTMNKILNQNLYAVDE 280 >gb|EKG14615.1| hypothetical protein MPH_08195 [Macrophomina phaseolina MS6] Length = 1154 Score = 88.2 bits (217), Expect = 2e-15 Identities = 41/43 (95%), Positives = 41/43 (95%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDPNDKRQIRCDE MRAVFKQDRVHMFTMNKILNQNLYA DE Sbjct: 1112 LQDPNDKRQIRCDEPMRAVFKQDRVHMFTMNKILNQNLYAVDE 1154 >gb|KKY16769.1| putative swib mdm2 domain-containing protein [Diplodia seriata] Length = 269 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/43 (95%), Positives = 41/43 (95%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDPNDKRQIRCDE MRAVFKQDRVHMFTMNKILNQNLYA DE Sbjct: 227 LQDPNDKRQIRCDEPMRAVFKQDRVHMFTMNKILNQNLYAIDE 269 >gb|KNG49136.1| secretion pathway protein sls2 rcy1 [Stemphylium lycopersici] Length = 1210 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDP+DKRQIRCD+AMRAVFKQDRVHMFTMNKILNQNLYA DE Sbjct: 1165 LQDPSDKRQIRCDDAMRAVFKQDRVHMFTMNKILNQNLYAVDE 1207 >ref|XP_003305343.1| hypothetical protein PTT_18158 [Pyrenophora teres f. teres 0-1] gi|311317686|gb|EFQ86572.1| hypothetical protein PTT_18158 [Pyrenophora teres f. teres 0-1] Length = 283 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDP+DKRQIRCD+AMRAVFKQDRVHMFTMNKILNQNLYA DE Sbjct: 238 LQDPSDKRQIRCDDAMRAVFKQDRVHMFTMNKILNQNLYAVDE 280 >ref|XP_001933158.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978722|gb|EDU45348.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 274 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDP+DKRQIRCD+AMRAVFKQDRVHMFTMNKILNQNLYA DE Sbjct: 229 LQDPSDKRQIRCDDAMRAVFKQDRVHMFTMNKILNQNLYAVDE 271 >ref|XP_001794015.1| hypothetical protein SNOG_03451 [Parastagonospora nodorum SN15] gi|160705881|gb|EAT88656.2| hypothetical protein SNOG_03451 [Parastagonospora nodorum SN15] Length = 275 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDP DKRQIRCD+AMRAVFKQDRVHMFTMNKILNQNLYA DE Sbjct: 217 LQDPADKRQIRCDDAMRAVFKQDRVHMFTMNKILNQNLYAVDE 259 >ref|XP_007782008.1| hypothetical protein W97_05937 [Coniosporium apollinis CBS 100218] gi|494830125|gb|EON66691.1| hypothetical protein W97_05937 [Coniosporium apollinis CBS 100218] Length = 320 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDP+DKRQIRCD+ MRAVFKQDRVHMFTMNKILNQNLYA DE Sbjct: 278 LQDPSDKRQIRCDDGMRAVFKQDRVHMFTMNKILNQNLYAQDE 320 >dbj|GAM90671.1| hypothetical protein ANO11243_087160 [fungal sp. No.11243] Length = 284 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDP+DKRQIRCD+AMR VFK DRVHMFTMNKILNQNLYAADE Sbjct: 242 LQDPSDKRQIRCDDAMRRVFKSDRVHMFTMNKILNQNLYAADE 284 >ref|XP_007584898.1| putative swib mdm2 domain protein [Neofusicoccum parvum UCRNP2] gi|485921965|gb|EOD47566.1| putative swib mdm2 domain protein [Neofusicoccum parvum UCRNP2] Length = 269 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDP DKRQIRCD+ MRAVFKQDRVHMFTMNKILNQNLYA DE Sbjct: 227 LQDPQDKRQIRCDDPMRAVFKQDRVHMFTMNKILNQNLYAVDE 269 >ref|XP_003833662.1| similar to SWIB/MDM2 domain-containing protein [Leptosphaeria maculans JN3] gi|312210210|emb|CBX90297.1| similar to SWIB/MDM2 domain-containing protein [Leptosphaeria maculans JN3] Length = 285 Score = 84.3 bits (207), Expect = 3e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDP DKRQIRCD+AMRAVFKQDRVHMFTMNKILNQNLYA +E Sbjct: 241 LQDPADKRQIRCDDAMRAVFKQDRVHMFTMNKILNQNLYAVEE 283 >dbj|GAQ11582.1| upstream activation factor subunit spp27 [Aspergillus lentulus] Length = 287 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDPND+RQIRCD+AMRAVFKQDR+HMFTM KILNQNLY+ DE Sbjct: 245 LQDPNDRRQIRCDDAMRAVFKQDRIHMFTMTKILNQNLYSPDE 287 >ref|XP_001265449.1| SWIB/MDM2 domain protein [Neosartorya fischeri NRRL 181] gi|119413611|gb|EAW23552.1| SWIB/MDM2 domain protein [Neosartorya fischeri NRRL 181] Length = 287 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDPND+RQIRCD+AMRAVFKQDR+HMFTM KILNQNLY+ DE Sbjct: 245 LQDPNDRRQIRCDDAMRAVFKQDRIHMFTMTKILNQNLYSPDE 287 >ref|XP_001269940.1| SWIB/MDM2 domain protein [Aspergillus clavatus NRRL 1] gi|119398083|gb|EAW08514.1| SWIB/MDM2 domain protein [Aspergillus clavatus NRRL 1] Length = 287 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDPND+RQIRCD+AMRAVFKQDR+HMFTM KILNQNLY+ DE Sbjct: 245 LQDPNDRRQIRCDDAMRAVFKQDRIHMFTMTKILNQNLYSPDE 287 >dbj|GAD93942.1| SWIB/MDM2 domain protein [Byssochlamys spectabilis No. 5] Length = 277 Score = 82.8 bits (203), Expect = 9e-14 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDPND+RQIRCD+AMRAVFKQDRVHMFTM KILNQNLY DE Sbjct: 235 LQDPNDRRQIRCDDAMRAVFKQDRVHMFTMTKILNQNLYNPDE 277 >ref|XP_001389048.2| SWIB/MDM2 domain protein [Aspergillus niger CBS 513.88] gi|350638168|gb|EHA26524.1| hypothetical protein ASPNIDRAFT_205951 [Aspergillus niger ATCC 1015] Length = 285 Score = 81.6 bits (200), Expect = 2e-13 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 259 LQDPNDKRQIRCDEAMRAVFKQDRVHMFTMNKILNQNLYAADE 131 LQDPND+RQIRCD+AMRAVFKQDR+HMFTM KIL+QNLY+ DE Sbjct: 243 LQDPNDRRQIRCDDAMRAVFKQDRIHMFTMTKILSQNLYSPDE 285