BLASTX nr result
ID: Ziziphus21_contig00046909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046909 (235 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002432901.1| conserved hypothetical protein [Pediculus hu... 88 2e-15 ref|XP_008189786.1| PREDICTED: sulfotransferase-like isoform X1 ... 87 6e-15 ref|NP_001155636.1| sulfotransferase-like [Acyrthosiphon pisum] ... 87 6e-15 ref|XP_014239915.1| PREDICTED: sulfotransferase family cytosolic... 86 8e-15 ref|XP_002423838.1| conserved hypothetical protein [Pediculus hu... 84 4e-14 gb|ETN60369.1| sulfotransferase (sult) [Anopheles darlingi] 84 4e-14 ref|XP_309706.4| AGAP010987-PA [Anopheles gambiae str. PEST] gi|... 82 1e-13 ref|XP_014290020.1| PREDICTED: estrogen sulfotransferase-like is... 82 2e-13 ref|XP_014290018.1| PREDICTED: estrogen sulfotransferase-like is... 82 2e-13 ref|XP_014290017.1| PREDICTED: sulfotransferase 1 family member ... 82 2e-13 ref|XP_008546683.1| PREDICTED: sulfotransferase 1C4 [Microplitis... 82 2e-13 gb|ETN60370.1| sulfotransferase (sult) [Anopheles darlingi] 82 2e-13 ref|XP_002430060.1| conserved hypothetical protein [Pediculus hu... 82 2e-13 ref|XP_001651919.1| AAEL006338-PA [Aedes aegypti] gi|94468670|gb... 81 3e-13 ref|XP_014273854.1| PREDICTED: sulfotransferase family cytosolic... 81 4e-13 ref|XP_001651918.1| AAEL006359-PA [Aedes aegypti] gi|108877853|g... 80 6e-13 ref|XP_014257095.1| PREDICTED: estrogen sulfotransferase-like [C... 79 1e-12 ref|XP_003490568.1| PREDICTED: sulfotransferase 4A1-like [Bombus... 79 1e-12 ref|XP_001993655.1| GH19934 [Drosophila grimshawi] gi|193895525|... 79 1e-12 ref|NP_649870.1| sulfotransferase 2, isoform A [Drosophila melan... 79 1e-12 >ref|XP_002432901.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518410|gb|EEB20163.1| conserved hypothetical protein [Pediculus humanus corporis] Length = 312 Score = 88.2 bits (217), Expect = 2e-15 Identities = 39/65 (60%), Positives = 49/65 (75%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 TV+QV SPRFIK+HLP+ LLP++LWTVKPKIIYV R+PKD IS YH M + Y G Sbjct: 113 TVEQVITMTSPRFIKSHLPYHLLPKQLWTVKPKIIYVYRDPKDAAISYYHHFKMYNWYEG 172 Query: 17 TFEEW 3 T +++ Sbjct: 173 TLDKF 177 >ref|XP_008189786.1| PREDICTED: sulfotransferase-like isoform X1 [Acyrthosiphon pisum] gi|239790272|dbj|BAH71707.1| ACYPI005632 [Acyrthosiphon pisum] Length = 324 Score = 86.7 bits (213), Expect = 6e-15 Identities = 38/65 (58%), Positives = 51/65 (78%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 +V+QV N SPRFIKTHLP LLP +L +VKPKI+YV RNPKD+ +S YH+ ++ G +G Sbjct: 118 SVEQVENMASPRFIKTHLPVPLLPEQLDSVKPKIVYVTRNPKDMCVSYYHYCKLIHGLHG 177 Query: 17 TFEEW 3 +FEE+ Sbjct: 178 SFEEF 182 >ref|NP_001155636.1| sulfotransferase-like [Acyrthosiphon pisum] gi|239790274|dbj|BAH71708.1| ACYPI005632 [Acyrthosiphon pisum] Length = 232 Score = 86.7 bits (213), Expect = 6e-15 Identities = 38/65 (58%), Positives = 51/65 (78%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 +V+QV N SPRFIKTHLP LLP +L +VKPKI+YV RNPKD+ +S YH+ ++ G +G Sbjct: 118 SVEQVENMASPRFIKTHLPVPLLPEQLDSVKPKIVYVTRNPKDMCVSYYHYCKLIHGLHG 177 Query: 17 TFEEW 3 +FEE+ Sbjct: 178 SFEEF 182 >ref|XP_014239915.1| PREDICTED: sulfotransferase family cytosolic 1B member 1-like [Cimex lectularius] Length = 369 Score = 86.3 bits (212), Expect = 8e-15 Identities = 37/65 (56%), Positives = 54/65 (83%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 +V+QV N +SPRFIKTHLP LLP++L+TVKPKIIYV RN KD+ +S +H+ +++ Y+G Sbjct: 164 SVEQVENTKSPRFIKTHLPRSLLPKQLFTVKPKIIYVTRNAKDMCVSYFHYTNLLHDYHG 223 Query: 17 TFEEW 3 +F+E+ Sbjct: 224 SFDEF 228 >ref|XP_002423838.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212507054|gb|EEB11100.1| conserved hypothetical protein [Pediculus humanus corporis] Length = 325 Score = 84.0 bits (206), Expect = 4e-14 Identities = 37/65 (56%), Positives = 49/65 (75%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 T++ AN + PR IK+HLP ELLP+ +WTVKPK+IYV R+P+DVVIS YH + +GY G Sbjct: 117 TIEISANLKRPRCIKSHLPVELLPKGIWTVKPKVIYVSRDPRDVVISYYHHYRLWNGYRG 176 Query: 17 TFEEW 3 T E + Sbjct: 177 TLENF 181 >gb|ETN60369.1| sulfotransferase (sult) [Anopheles darlingi] Length = 321 Score = 84.0 bits (206), Expect = 4e-14 Identities = 39/63 (61%), Positives = 44/63 (69%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 TV AN + PR IK+HLP LLPR+LWTVKPKI+YV RNPKDV S H M+ GY G Sbjct: 117 TVTATANLKRPRHIKSHLPLPLLPRQLWTVKPKIVYVTRNPKDVAASYLHHYRMIMGYRG 176 Query: 17 TFE 9 T E Sbjct: 177 TKE 179 >ref|XP_309706.4| AGAP010987-PA [Anopheles gambiae str. PEST] gi|157019365|gb|EAA05552.4| AGAP010987-PA [Anopheles gambiae str. PEST] Length = 339 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/63 (58%), Positives = 45/63 (71%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 TV A+ + PR IK+HLP LLPR+LWTVKP+I+YV RNPKDV +S H M+ GY G Sbjct: 134 TVTVAASMKRPRHIKSHLPMALLPRQLWTVKPRIVYVARNPKDVAVSYLHHYRMIMGYRG 193 Query: 17 TFE 9 T E Sbjct: 194 TKE 196 >ref|XP_014290020.1| PREDICTED: estrogen sulfotransferase-like isoform X3 [Halyomorpha halys] Length = 320 Score = 82.0 bits (201), Expect = 2e-13 Identities = 34/65 (52%), Positives = 52/65 (80%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 +VD + +SPRFIKTHLP LLP++++TV+PKIIYV RNPKD+ +S YH+ ++ ++G Sbjct: 117 SVDLAESMKSPRFIKTHLPVTLLPKQIFTVRPKIIYVSRNPKDMCVSYYHYCRLLHDFHG 176 Query: 17 TFEEW 3 +FE++ Sbjct: 177 SFEDF 181 >ref|XP_014290018.1| PREDICTED: estrogen sulfotransferase-like isoform X2 [Halyomorpha halys] Length = 323 Score = 82.0 bits (201), Expect = 2e-13 Identities = 34/65 (52%), Positives = 52/65 (80%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 +VD + +SPRFIKTHLP LLP++++TV+PKIIYV RNPKD+ +S YH+ ++ ++G Sbjct: 117 SVDLAESMKSPRFIKTHLPVTLLPKQIFTVRPKIIYVSRNPKDMCVSYYHYCRLLHDFHG 176 Query: 17 TFEEW 3 +FE++ Sbjct: 177 SFEDF 181 >ref|XP_014290017.1| PREDICTED: sulfotransferase 1 family member D1-like isoform X1 [Halyomorpha halys] Length = 326 Score = 82.0 bits (201), Expect = 2e-13 Identities = 34/65 (52%), Positives = 52/65 (80%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 +VD + +SPRFIKTHLP LLP++++TV+PKIIYV RNPKD+ +S YH+ ++ ++G Sbjct: 117 SVDLAESMKSPRFIKTHLPVTLLPKQIFTVRPKIIYVSRNPKDMCVSYYHYCRLLHDFHG 176 Query: 17 TFEEW 3 +FE++ Sbjct: 177 SFEDF 181 >ref|XP_008546683.1| PREDICTED: sulfotransferase 1C4 [Microplitis demolitor] Length = 339 Score = 82.0 bits (201), Expect = 2e-13 Identities = 36/64 (56%), Positives = 48/64 (75%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 +V+ V PR+IK+HLP+ELLP++L + KPKIIYV RNPKD +S YH+ ++ YNG Sbjct: 118 SVENVEKISRPRYIKSHLPWELLPQQLKSKKPKIIYVTRNPKDTCVSLYHYCKLMHDYNG 177 Query: 17 TFEE 6 TFEE Sbjct: 178 TFEE 181 >gb|ETN60370.1| sulfotransferase (sult) [Anopheles darlingi] Length = 285 Score = 82.0 bits (201), Expect = 2e-13 Identities = 40/65 (61%), Positives = 47/65 (72%), Gaps = 3/65 (4%) Frame = -3 Query: 194 VDQVANAES---PRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGY 24 +D +A AE PR IK+HLP LLPR+LWTVKPKI+YV RNPKDV IS +H + GY Sbjct: 78 IDTIAVAEKSPRPRQIKSHLPLSLLPRQLWTVKPKIVYVARNPKDVAISFFHHYRVFVGY 137 Query: 23 NGTFE 9 NGT E Sbjct: 138 NGTKE 142 >ref|XP_002430060.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212515130|gb|EEB17322.1| conserved hypothetical protein [Pediculus humanus corporis] Length = 321 Score = 81.6 bits (200), Expect = 2e-13 Identities = 35/65 (53%), Positives = 49/65 (75%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 +VD V N SPRFIK+HLP+ELLP+ L V+PK++YV RNPKD+ +S YH+ +V G Sbjct: 118 SVDLVENLTSPRFIKSHLPWELLPKDLKIVQPKVVYVARNPKDMCVSYYHYCQLVHNMKG 177 Query: 17 TFEEW 3 +FE++ Sbjct: 178 SFEDF 182 >ref|XP_001651919.1| AAEL006338-PA [Aedes aegypti] gi|94468670|gb|ABF18184.1| sulfotransferase [Aedes aegypti] gi|108877854|gb|EAT42079.1| AAEL006338-PA [Aedes aegypti] Length = 339 Score = 81.3 bits (199), Expect = 3e-13 Identities = 40/67 (59%), Positives = 47/67 (70%), Gaps = 3/67 (4%) Frame = -3 Query: 194 VDQVANAES---PRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGY 24 VD VA A S PR IK+HLP LLP++LWTVKPKIIYV RNPKDV +S +H M+ GY Sbjct: 133 VDTVAAAASKARPRHIKSHLPLALLPKQLWTVKPKIIYVSRNPKDVAVSYWHHYKMIMGY 192 Query: 23 NGTFEEW 3 G E + Sbjct: 193 RGPREHF 199 >ref|XP_014273854.1| PREDICTED: sulfotransferase family cytosolic 1B member 1-like [Halyomorpha halys] Length = 333 Score = 80.9 bits (198), Expect = 4e-13 Identities = 34/63 (53%), Positives = 45/63 (71%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 T+ + SPR+IKTHLP LLP ++WTVKPK+IYV RNPKDV +S YH + +GY G Sbjct: 125 TISYTEDLPSPRYIKTHLPVSLLPEQIWTVKPKMIYVTRNPKDVAVSYYHHHRLWNGYTG 184 Query: 17 TFE 9 ++ Sbjct: 185 LYQ 187 >ref|XP_001651918.1| AAEL006359-PA [Aedes aegypti] gi|108877853|gb|EAT42078.1| AAEL006359-PA [Aedes aegypti] Length = 304 Score = 80.1 bits (196), Expect = 6e-13 Identities = 37/63 (58%), Positives = 44/63 (69%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 TV++V N E PR IK+HLP LLP +LWTV+PKIIY RNPKDV +S H + GY G Sbjct: 124 TVERVENLERPRHIKSHLPLALLPSQLWTVQPKIIYCARNPKDVAVSYMHHYRHLHGYKG 183 Query: 17 TFE 9 T E Sbjct: 184 TNE 186 >ref|XP_014257095.1| PREDICTED: estrogen sulfotransferase-like [Cimex lectularius] Length = 331 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/62 (54%), Positives = 44/62 (70%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 T+ SPRFIK+HLP LLP ++WTVKPK+IYV RNPKD +S YH + +GYNG Sbjct: 125 TISFTEELPSPRFIKSHLPVSLLPDQIWTVKPKMIYVTRNPKDAAVSYYHHHRLWNGYNG 184 Query: 17 TF 12 ++ Sbjct: 185 SY 186 >ref|XP_003490568.1| PREDICTED: sulfotransferase 4A1-like [Bombus impatiens] Length = 324 Score = 79.3 bits (194), Expect = 1e-12 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 2/67 (2%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWT--VKPKIIYVCRNPKDVVISQYHFISMVSGY 24 +V+ N SPRFIKTHLPF+LLPR++ T KPKIIYV RNPKD IS +H ++ GY Sbjct: 121 SVEYTKNKASPRFIKTHLPFDLLPRQIRTGEKKPKIIYVARNPKDTCISYFHHCQIIEGY 180 Query: 23 NGTFEEW 3 G F ++ Sbjct: 181 RGNFSDF 187 >ref|XP_001993655.1| GH19934 [Drosophila grimshawi] gi|193895525|gb|EDV94391.1| GH19934 [Drosophila grimshawi] Length = 316 Score = 79.0 bits (193), Expect = 1e-12 Identities = 33/65 (50%), Positives = 47/65 (72%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 TV+QV N PR+ ++HL ++LLP + TVKPKI+Y RNPKDV +S YH+ ++ G NG Sbjct: 118 TVEQVRNLPRPRYARSHLSWQLLPEQFETVKPKIVYTARNPKDVCVSYYHYCKLLHGING 177 Query: 17 TFEEW 3 FE++ Sbjct: 178 DFEQF 182 >ref|NP_649870.1| sulfotransferase 2, isoform A [Drosophila melanogaster] gi|665393611|ref|NP_001287244.1| sulfotransferase 2, isoform B [Drosophila melanogaster] gi|7299146|gb|AAF54344.1| sulfotransferase 2, isoform A [Drosophila melanogaster] gi|345091099|gb|ADM26248.2| MIP25022p1 [Drosophila melanogaster] gi|599127651|gb|AHN57243.1| sulfotransferase 2, isoform B [Drosophila melanogaster] Length = 316 Score = 79.0 bits (193), Expect = 1e-12 Identities = 33/65 (50%), Positives = 46/65 (70%) Frame = -3 Query: 197 TVDQVANAESPRFIKTHLPFELLPRKLWTVKPKIIYVCRNPKDVVISQYHFISMVSGYNG 18 TVD V N PRF ++HLP+ LLP + TVKP+I+Y RNPKD+ +S YH+ ++ G NG Sbjct: 118 TVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMNG 177 Query: 17 TFEEW 3 FE++ Sbjct: 178 DFEQF 182