BLASTX nr result
ID: Ziziphus21_contig00046884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046884 (460 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG12586.1| Basic-leucine zipper (bZIP) transcription factor ... 66 9e-09 ref|XP_007587582.1| putative bzip transcription factor protein [... 62 1e-07 gb|KKY18833.1| putative bzip family transcription factor [Diplod... 60 5e-07 >gb|EKG12586.1| Basic-leucine zipper (bZIP) transcription factor [Macrophomina phaseolina MS6] Length = 551 Score = 66.2 bits (160), Expect = 9e-09 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 460 VVVAQETSEQLQQRLERSIAKFDAVYERMQSMML 359 VVVAQETSEQLQQRLERSIAKFDAVYERMQSMML Sbjct: 518 VVVAQETSEQLQQRLERSIAKFDAVYERMQSMML 551 >ref|XP_007587582.1| putative bzip transcription factor protein [Neofusicoccum parvum UCRNP2] gi|485918247|gb|EOD44948.1| putative bzip transcription factor protein [Neofusicoccum parvum UCRNP2] Length = 771 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 460 VVVAQETSEQLQQRLERSIAKFDAVYERMQSMM 362 VVV+QET+EQLQQRLERSIAKFDAVYERMQSMM Sbjct: 537 VVVSQETTEQLQQRLERSIAKFDAVYERMQSMM 569 >gb|KKY18833.1| putative bzip family transcription factor [Diplodia seriata] Length = 565 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 460 VVVAQETSEQLQQRLERSIAKFDAVYERMQSMML 359 VVVAQETS QLQQRLER++AKFDAVYERMQ MML Sbjct: 532 VVVAQETSAQLQQRLERTVAKFDAVYERMQRMML 565