BLASTX nr result
ID: Ziziphus21_contig00046820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046820 (263 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY26170.1| putative protein phosphatase pp2a regulatory subu... 59 1e-06 ref|XP_007580357.1| putative protein phosphatase pp2a regulatory... 59 1e-06 gb|EKG22186.1| Protein phosphatase 2A regulatory subunit PR55 [M... 59 1e-06 gb|KJY00001.1| hypothetical protein TI39_contig345g00069 [Zymose... 57 5e-06 gb|EMF17256.1| protein phosphatase PP2A regulatory subunit B [Sp... 57 7e-06 ref|XP_007921428.1| hypothetical protein MYCFIDRAFT_209783 [Pseu... 57 7e-06 gb|EME49456.1| hypothetical protein DOTSEDRAFT_163851 [Dothistro... 57 7e-06 ref|XP_007679234.1| hypothetical protein BAUCODRAFT_37069 [Baudo... 57 7e-06 ref|XP_003856945.1| MgPP2Aregb1, protein phosphatase regulatory ... 57 7e-06 gb|KNG46460.1| glycosyltransferase family 39 protein [Stemphyliu... 56 9e-06 >gb|KKY26170.1| putative protein phosphatase pp2a regulatory subunit b [Diplodia seriata] Length = 487 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 262 ILHMSWHPNEDSIAIAATNNLFVFSAL 182 ILHMSWHPNEDSIAIAATNNLFVFSAL Sbjct: 461 ILHMSWHPNEDSIAIAATNNLFVFSAL 487 >ref|XP_007580357.1| putative protein phosphatase pp2a regulatory subunit b protein [Neofusicoccum parvum UCRNP2] gi|485928525|gb|EOD52232.1| putative protein phosphatase pp2a regulatory subunit b protein [Neofusicoccum parvum UCRNP2] Length = 481 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 262 ILHMSWHPNEDSIAIAATNNLFVFSAL 182 ILHMSWHPNEDSIAIAATNNLFVFSAL Sbjct: 455 ILHMSWHPNEDSIAIAATNNLFVFSAL 481 >gb|EKG22186.1| Protein phosphatase 2A regulatory subunit PR55 [Macrophomina phaseolina MS6] Length = 481 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 262 ILHMSWHPNEDSIAIAATNNLFVFSAL 182 ILHMSWHPNEDSIAIAATNNLFVFSAL Sbjct: 455 ILHMSWHPNEDSIAIAATNNLFVFSAL 481 >gb|KJY00001.1| hypothetical protein TI39_contig345g00069 [Zymoseptoria brevis] Length = 914 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 262 ILHMSWHPNEDSIAIAATNNLFVFSAL*EEQ 170 ILHMSWHP EDSIAIAATNNLFVFSAL E+ Sbjct: 524 ILHMSWHPQEDSIAIAATNNLFVFSALSPEK 554 >gb|EMF17256.1| protein phosphatase PP2A regulatory subunit B [Sphaerulina musiva SO2202] Length = 480 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 262 ILHMSWHPNEDSIAIAATNNLFVFSAL 182 ILHMSWHP EDSIAIAATNNLFVFSAL Sbjct: 454 ILHMSWHPQEDSIAIAATNNLFVFSAL 480 >ref|XP_007921428.1| hypothetical protein MYCFIDRAFT_209783 [Pseudocercospora fijiensis CIRAD86] gi|452988600|gb|EME88355.1| hypothetical protein MYCFIDRAFT_209783 [Pseudocercospora fijiensis CIRAD86] Length = 477 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 262 ILHMSWHPNEDSIAIAATNNLFVFSAL 182 ILHMSWHP EDSIAIAATNNLFVFSAL Sbjct: 451 ILHMSWHPQEDSIAIAATNNLFVFSAL 477 >gb|EME49456.1| hypothetical protein DOTSEDRAFT_163851 [Dothistroma septosporum NZE10] Length = 482 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 262 ILHMSWHPNEDSIAIAATNNLFVFSAL 182 ILHMSWHP EDSIAIAATNNLFVFSAL Sbjct: 456 ILHMSWHPQEDSIAIAATNNLFVFSAL 482 >ref|XP_007679234.1| hypothetical protein BAUCODRAFT_37069 [Baudoinia panamericana UAMH 10762] gi|449297358|gb|EMC93376.1| hypothetical protein BAUCODRAFT_37069 [Baudoinia panamericana UAMH 10762] Length = 483 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 262 ILHMSWHPNEDSIAIAATNNLFVFSAL 182 ILHMSWHP EDSIAIAATNNLFVFSAL Sbjct: 457 ILHMSWHPQEDSIAIAATNNLFVFSAL 483 >ref|XP_003856945.1| MgPP2Aregb1, protein phosphatase regulatory beta sub-unit 1 [Zymoseptoria tritici IPO323] gi|339476830|gb|EGP91921.1| MgPP2Aregb1, protein phosphatase regulatory beta sub-unit 1 [Zymoseptoria tritici IPO323] Length = 482 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 262 ILHMSWHPNEDSIAIAATNNLFVFSAL 182 ILHMSWHP EDSIAIAATNNLFVFSAL Sbjct: 456 ILHMSWHPQEDSIAIAATNNLFVFSAL 482 >gb|KNG46460.1| glycosyltransferase family 39 protein [Stemphylium lycopersici] Length = 1578 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 262 ILHMSWHPNEDSIAIAATNNLFVFSAL*EEQ 170 ILHMSWHP EDSIAIAATNNLFVFSAL E + Sbjct: 461 ILHMSWHPFEDSIAIAATNNLFVFSALQEPE 491