BLASTX nr result
ID: Ziziphus21_contig00046713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046713 (257 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KPI35803.1| hypothetical protein AB675_11183 [Phialophora attae] 60 8e-07 >gb|KPI35803.1| hypothetical protein AB675_11183 [Phialophora attae] Length = 177 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -1 Query: 257 VNGFTLLKANADKLIYYQYVEFNSLAWAENFGFTVIAPTYG 135 + G T++K N+DK +YYQ V FNSLAWAEN GFTVI P G Sbjct: 134 IEGVTIIKVNSDKKVYYQKVIFNSLAWAENIGFTVIPPAGG 174