BLASTX nr result
ID: Ziziphus21_contig00046580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00046580 (242 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001155980.1| growth arrest and DNA-damage-inducible, gamm... 57 5e-06 >ref|NP_001155980.1| growth arrest and DNA-damage-inducible, gamma interacting protein 1 [Acyrthosiphon pisum] gi|239799470|dbj|BAH70654.1| ACYPI48967 [Acyrthosiphon pisum] Length = 246 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = -2 Query: 241 KKIREKILGKIAEAQEAKKKRDALLEEIKRHFGYTIDPKD 122 K+++EK K+ EAQ+AK+K++ L+EE+K+HFGY IDPKD Sbjct: 168 KEVKEKSAKKLLEAQQAKEKKEKLIEEVKKHFGYKIDPKD 207