BLASTX nr result
ID: Ziziphus21_contig00045836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045836 (317 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG13301.1| Ribosomal protein L27/L41 mitochondrial [Macropho... 74 4e-11 ref|XP_007582378.1| putative 50s ribosomal protein 27 protein [N... 71 4e-10 gb|KKY25863.1| putative 50s ribosomal protein 27 [Diplodia seriata] 61 4e-07 >gb|EKG13301.1| Ribosomal protein L27/L41 mitochondrial [Macrophomina phaseolina MS6] Length = 103 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 316 VTPPTGRGNYPDKLGPLSGKLYLEKWKSENGQD 218 VTPPTGRGNYPDK+GPLSGKLYLEKWK+ENGQD Sbjct: 71 VTPPTGRGNYPDKMGPLSGKLYLEKWKAENGQD 103 >ref|XP_007582378.1| putative 50s ribosomal protein 27 protein [Neofusicoccum parvum UCRNP2] gi|485925608|gb|EOD50131.1| putative 50s ribosomal protein 27 protein [Neofusicoccum parvum UCRNP2] Length = 103 Score = 70.9 bits (172), Expect = 4e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 316 VTPPTGRGNYPDKLGPLSGKLYLEKWKSENGQD 218 VTPP GRGNYPDKLGPLSGKLYLEKWK+ENG+D Sbjct: 71 VTPPLGRGNYPDKLGPLSGKLYLEKWKAENGKD 103 >gb|KKY25863.1| putative 50s ribosomal protein 27 [Diplodia seriata] Length = 103 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 316 VTPPTGRGNYPDKLGPLSGKLYLEKWKSENGQD 218 VT T RG YPDKLGPLSG+LYLEKWK+ENGQD Sbjct: 71 VTLSTSRGIYPDKLGPLSGRLYLEKWKAENGQD 103