BLASTX nr result
ID: Ziziphus21_contig00045802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045802 (401 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFM73521.1| Mitochondrial import receptor subunit TOM7-like p... 62 1e-07 ref|XP_004535872.1| PREDICTED: mitochondrial import receptor sub... 60 6e-07 ref|XP_001238152.1| AGAP010227-PA [Anopheles gambiae str. PEST] ... 60 8e-07 ref|XP_013098073.1| PREDICTED: mitochondrial import receptor sub... 59 1e-06 gb|KNC21815.1| hypothetical protein FF38_03171 [Lucilia cuprina] 59 1e-06 ref|XP_014091510.1| PREDICTED: mitochondrial import receptor sub... 59 2e-06 ref|XP_011200981.1| PREDICTED: mitochondrial import receptor sub... 59 2e-06 ref|XP_005177077.1| PREDICTED: mitochondrial import receptor sub... 59 2e-06 ref|XP_012274872.1| PREDICTED: mitochondrial import receptor sub... 58 3e-06 ref|XP_011186971.1| PREDICTED: mitochondrial import receptor sub... 58 3e-06 ref|NP_610433.1| translocase of outer membrane 7, isoform A [Dro... 57 4e-06 ref|XP_001360112.1| GA20911 [Drosophila pseudoobscura pseudoobsc... 57 4e-06 ref|XP_014223203.1| PREDICTED: mitochondrial import receptor sub... 57 5e-06 ref|XP_008557867.1| PREDICTED: mitochondrial import receptor sub... 57 5e-06 gb|KOX79208.1| Mitochondrial import receptor subunit TOM7 like p... 57 7e-06 ref|XP_012255426.1| PREDICTED: mitochondrial import receptor sub... 57 7e-06 ref|XP_011865359.1| PREDICTED: mitochondrial import receptor sub... 56 9e-06 ref|NP_001155867.1| translocase of outer mitochondrial membrane ... 56 9e-06 ref|XP_001636802.1| predicted protein [Nematostella vectensis] g... 56 9e-06 >gb|KFM73521.1| Mitochondrial import receptor subunit TOM7-like protein, partial [Stegodyphus mimosarum] Length = 52 Score = 62.4 bits (150), Expect = 1e-07 Identities = 24/45 (53%), Positives = 32/45 (71%) Frame = -2 Query: 277 MKADVKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMPSFT 143 M + K RI +F ++K F WGFI T++YLG++KGADPGMP T Sbjct: 1 MNPETKKRIGHVFNILKTAFRWGFIPTVVYLGYKKGADPGMPEIT 45 >ref|XP_004535872.1| PREDICTED: mitochondrial import receptor subunit TOM7 homolog [Ceratitis capitata] gi|807041338|ref|XP_012161380.1| PREDICTED: mitochondrial import receptor subunit TOM7 homolog [Ceratitis capitata] Length = 54 Score = 60.1 bits (144), Expect = 6e-07 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = -2 Query: 265 VKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMPSFT 143 VK R+ ++ + K TFHWGFI +IYLGF+KGA+PGMP T Sbjct: 7 VKERLEVVYDVAKTTFHWGFIPMVIYLGFRKGAEPGMPPLT 47 >ref|XP_001238152.1| AGAP010227-PA [Anopheles gambiae str. PEST] gi|116118524|gb|EAU76137.1| AGAP010227-PA [Anopheles gambiae str. PEST] Length = 52 Score = 59.7 bits (143), Expect = 8e-07 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = -2 Query: 280 IMKADVKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMP 152 ++ VK RI +F ++K +FHWGFI T++YLGF+KG++PGMP Sbjct: 1 MLSPGVKERIGVVFEVVKTSFHWGFIPTLLYLGFRKGSEPGMP 43 >ref|XP_013098073.1| PREDICTED: mitochondrial import receptor subunit TOM7 homolog [Stomoxys calcitrans] Length = 54 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/41 (53%), Positives = 31/41 (75%) Frame = -2 Query: 265 VKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMPSFT 143 VK R+ ++ + K TFHWGF+ ++YLGF+KGA+PGMP T Sbjct: 7 VKERLEVVYEIAKTTFHWGFVPMVLYLGFKKGAEPGMPPLT 47 >gb|KNC21815.1| hypothetical protein FF38_03171 [Lucilia cuprina] Length = 81 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/41 (53%), Positives = 31/41 (75%) Frame = -2 Query: 265 VKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMPSFT 143 VK R+ ++ + K TFHWGF+ ++YLGF+KGA+PGMP T Sbjct: 34 VKERLEVVYEIAKTTFHWGFVPMVLYLGFKKGAEPGMPPLT 74 >ref|XP_014091510.1| PREDICTED: mitochondrial import receptor subunit TOM7 homolog [Bactrocera oleae] Length = 54 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -2 Query: 265 VKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMP 152 VK R+ ++ + K TFHWGFI +IYLGF+KGA+PGMP Sbjct: 7 VKERLEVVYDVAKTTFHWGFIPMVIYLGFRKGAEPGMP 44 >ref|XP_011200981.1| PREDICTED: mitochondrial import receptor subunit TOM7 homolog [Bactrocera dorsalis] Length = 54 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -2 Query: 265 VKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMP 152 VK R+ ++ + K TFHWGFI +IYLGF+KGA+PGMP Sbjct: 7 VKERLEVVYDVAKTTFHWGFIPMVIYLGFRKGAEPGMP 44 >ref|XP_005177077.1| PREDICTED: mitochondrial import receptor subunit TOM7 homolog [Musca domestica] Length = 54 Score = 58.5 bits (140), Expect = 2e-06 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = -2 Query: 277 MKADVKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMP 152 M VK R+ ++ + K TFHWGF+ ++YLGF+KGA+PGMP Sbjct: 3 MSPGVKERLEVVYEIAKTTFHWGFVPMVLYLGFKKGAEPGMP 44 >ref|XP_012274872.1| PREDICTED: mitochondrial import receptor subunit TOM7 homolog [Orussus abietinus] Length = 54 Score = 57.8 bits (138), Expect = 3e-06 Identities = 22/45 (48%), Positives = 31/45 (68%) Frame = -2 Query: 277 MKADVKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMPSFT 143 + K +I+ + + KV FHWGFI ++YLGF+KGA+PGMP T Sbjct: 3 LSPQTKQKIAVILDISKVVFHWGFIPAVLYLGFKKGAEPGMPPLT 47 >ref|XP_011186971.1| PREDICTED: mitochondrial import receptor subunit TOM7 homolog [Bactrocera cucurbitae] Length = 54 Score = 57.8 bits (138), Expect = 3e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = -2 Query: 265 VKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMP 152 VK R+ ++ + K TFHWGFI ++YLGF+KGA+PGMP Sbjct: 7 VKERLEVVYDVAKTTFHWGFIPMVLYLGFRKGAEPGMP 44 >ref|NP_610433.1| translocase of outer membrane 7, isoform A [Drosophila melanogaster] gi|665399669|ref|NP_001286220.1| translocase of outer membrane 7, isoform B [Drosophila melanogaster] gi|17944733|gb|AAL48434.1| AT23266p [Drosophila melanogaster] gi|21645577|gb|AAF59012.2| translocase of outer membrane 7, isoform A [Drosophila melanogaster] gi|220950960|gb|ACL88023.1| Tom7-PA, partial [synthetic construct] gi|220957954|gb|ACL91520.1| Tom7-PA [synthetic construct] gi|599126722|gb|AHN56018.1| translocase of outer membrane 7, isoform B [Drosophila melanogaster] Length = 54 Score = 57.4 bits (137), Expect = 4e-06 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = -2 Query: 265 VKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMP 152 VK R+ F+ G+++ FHWGF+ ++YLGF KGA+PGMP Sbjct: 7 VKDRLGFVVGVVQTGFHWGFVPLVLYLGFMKGAEPGMP 44 >ref|XP_001360112.1| GA20911 [Drosophila pseudoobscura pseudoobscura] gi|195149020|ref|XP_002015457.1| GL11011 [Drosophila persimilis] gi|54635283|gb|EAL24686.1| uncharacterized protein Dpse_GA20911 [Drosophila pseudoobscura pseudoobscura] gi|194109304|gb|EDW31347.1| GL11011 [Drosophila persimilis] Length = 54 Score = 57.4 bits (137), Expect = 4e-06 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = -2 Query: 265 VKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMP 152 VK R+ + G+++ TFHWGF+ ++YLGF KGA+PGMP Sbjct: 7 VKERLGVVVGVVQTTFHWGFVPMVLYLGFSKGAEPGMP 44 >ref|XP_014223203.1| PREDICTED: mitochondrial import receptor subunit TOM7 homolog [Trichogramma pretiosum] Length = 54 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/41 (53%), Positives = 29/41 (70%) Frame = -2 Query: 265 VKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMPSFT 143 VK +IS + L + FHWGFI ++YLGF+KG DPGMP + Sbjct: 7 VKQKISVVLALSRTAFHWGFIPAVLYLGFRKGTDPGMPELS 47 >ref|XP_008557867.1| PREDICTED: mitochondrial import receptor subunit TOM7 homolog [Microplitis demolitor] Length = 54 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = -2 Query: 277 MKADVKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMPSFT 143 M K ++S + + K FHWGFI T+IYLGF+KGADPGM T Sbjct: 3 MTPRTKQKVSTVLEITKTVFHWGFIPTVIYLGFRKGADPGMTPLT 47 >gb|KOX79208.1| Mitochondrial import receptor subunit TOM7 like protein [Melipona quadrifasciata] Length = 52 Score = 56.6 bits (135), Expect = 7e-06 Identities = 22/45 (48%), Positives = 30/45 (66%) Frame = -2 Query: 277 MKADVKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMPSFT 143 M K +I+ + + K FHWGFI I++LGF+KGADPGMP + Sbjct: 1 MNPTTKQKIAIILNVSKTVFHWGFIPAILFLGFRKGADPGMPQLS 45 >ref|XP_012255426.1| PREDICTED: mitochondrial import receptor subunit TOM7 homolog [Athalia rosae] Length = 54 Score = 56.6 bits (135), Expect = 7e-06 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = -2 Query: 262 KSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMP 152 K +IS + + KV FHWGFI +++LGF+KGADPGMP Sbjct: 8 KQKISIVVNVTKVVFHWGFIPAVLFLGFRKGADPGMP 44 >ref|XP_011865359.1| PREDICTED: mitochondrial import receptor subunit TOM7 homolog [Vollenhovia emeryi] Length = 54 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/46 (47%), Positives = 31/46 (67%) Frame = -2 Query: 280 IMKADVKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMPSFT 143 ++ K R++ + + K F WGFI +II+LGF+KGADPGMP T Sbjct: 2 VLSPTAKQRVAIVLNVSKFVFQWGFIPSIIFLGFRKGADPGMPELT 47 >ref|NP_001155867.1| translocase of outer mitochondrial membrane 7 homolog [Nasonia vitripennis] gi|645004190|ref|XP_008208148.1| PREDICTED: translocase of outer mitochondrial membrane 7 homolog isoform X1 [Nasonia vitripennis] gi|645004192|ref|XP_008208152.1| PREDICTED: translocase of outer mitochondrial membrane 7 homolog isoform X1 [Nasonia vitripennis] gi|645004194|ref|XP_008208156.1| PREDICTED: translocase of outer mitochondrial membrane 7 homolog isoform X1 [Nasonia vitripennis] Length = 54 Score = 56.2 bits (134), Expect = 9e-06 Identities = 21/45 (46%), Positives = 30/45 (66%) Frame = -2 Query: 277 MKADVKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMPSFT 143 + K +IS + + K FHWGFI ++YLGF++GADPGMP + Sbjct: 3 LSPQTKQKISVVLNVSKTVFHWGFIPAVLYLGFRRGADPGMPELS 47 >ref|XP_001636802.1| predicted protein [Nematostella vectensis] gi|156223909|gb|EDO44739.1| predicted protein [Nematostella vectensis] Length = 152 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/47 (53%), Positives = 30/47 (63%) Frame = -2 Query: 283 AIMKADVKSRISFLFGLMKVTFHWGFIQTIIYLGFQKGADPGMPSFT 143 A MK + K R+ + K FHWGFI IIYLG ++GADPGMP T Sbjct: 2 AKMKPETKKRVQTVIKYSKTAFHWGFIPLIIYLGLKRGADPGMPEPT 48