BLASTX nr result
ID: Ziziphus21_contig00045782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045782 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY17248.1| putative ccr4-not transcription complex subunit [... 67 5e-09 ref|XP_007583878.1| putative ccr4-not transcription complex subu... 67 5e-09 gb|EKG20345.1| CCR4-Not complex component Not1 [Macrophomina pha... 67 5e-09 >gb|KKY17248.1| putative ccr4-not transcription complex subunit [Diplodia seriata] Length = 2170 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 306 WELPFVKAAPEVERLFGALFQHINQSPRAIS 214 WELPFVKAAPEVERLFGALFQHINQSPRAIS Sbjct: 2140 WELPFVKAAPEVERLFGALFQHINQSPRAIS 2170 >ref|XP_007583878.1| putative ccr4-not transcription complex subunit protein [Neofusicoccum parvum UCRNP2] gi|485923516|gb|EOD48665.1| putative ccr4-not transcription complex subunit protein [Neofusicoccum parvum UCRNP2] Length = 2088 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 306 WELPFVKAAPEVERLFGALFQHINQSPRAIS 214 WELPFVKAAPEVERLFGALFQHINQSPRAIS Sbjct: 2058 WELPFVKAAPEVERLFGALFQHINQSPRAIS 2088 >gb|EKG20345.1| CCR4-Not complex component Not1 [Macrophomina phaseolina MS6] Length = 2292 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 306 WELPFVKAAPEVERLFGALFQHINQSPRAIS 214 WELPFVKAAPEVERLFGALFQHINQSPRAIS Sbjct: 2262 WELPFVKAAPEVERLFGALFQHINQSPRAIS 2292