BLASTX nr result
ID: Ziziphus21_contig00045739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045739 (401 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007583089.1| hypothetical protein UCRNP2_3798 [Neofusicoc... 76 9e-12 gb|EKG15063.1| hypothetical protein MPH_07746 [Macrophomina phas... 69 1e-09 gb|KKY19592.1| hypothetical protein UCDDS831_g05251 [Diplodia se... 65 3e-08 >ref|XP_007583089.1| hypothetical protein UCRNP2_3798 [Neofusicoccum parvum UCRNP2] gi|485924677|gb|EOD49419.1| hypothetical protein UCRNP2_3798 [Neofusicoccum parvum UCRNP2] Length = 160 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 399 YGRHSNQWLFGGFSVRESVKGAYHHFRGDSHDSN 298 YGRHSNQWLFGGFSVRESVKGAYHHFRG+SHDS+ Sbjct: 127 YGRHSNQWLFGGFSVRESVKGAYHHFRGESHDSH 160 >gb|EKG15063.1| hypothetical protein MPH_07746 [Macrophomina phaseolina MS6] Length = 176 Score = 69.3 bits (168), Expect = 1e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 399 YGRHSNQWLFGGFSVRESVKGAYHHFRGDSH 307 YGRHSNQWLFGGFSVRE+VKGAYHHFR DSH Sbjct: 146 YGRHSNQWLFGGFSVRETVKGAYHHFRHDSH 176 >gb|KKY19592.1| hypothetical protein UCDDS831_g05251 [Diplodia seriata] Length = 173 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 399 YGRHSNQWLFGGFSVRESVKGAYHHFRGDSH 307 YGRH+NQWLFGGFSVRE+VK AYHH RG+SH Sbjct: 143 YGRHTNQWLFGGFSVRETVKDAYHHIRGESH 173