BLASTX nr result
ID: Ziziphus21_contig00045696
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045696 (405 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG13509.1| hypothetical protein MPH_09341 [Macrophomina phas... 95 2e-17 ref|XP_007585949.1| putative -dihydroxy-2-butanone 4-phosphate s... 90 6e-16 gb|KKY26792.1| putative dihydroxy-2-butanone 4-phosphate synthas... 89 2e-15 ref|XP_007782169.1| 3,4-dihydroxy-2-butanone 4-phosphate synthas... 73 7e-11 gb|KFZ15606.1| hypothetical protein V501_02641 [Pseudogymnoascus... 72 2e-10 gb|KIW02523.1| 3,4-dihydroxy-2-butanone-4-phosphate synthase [Ve... 70 6e-10 ref|XP_014552582.1| hypothetical protein COCVIDRAFT_109995 [Bipo... 70 8e-10 ref|XP_007688974.1| hypothetical protein COCMIDRAFT_6209 [Bipola... 70 8e-10 ref|XP_007713961.1| hypothetical protein COCCADRAFT_100505 [Bipo... 70 8e-10 ref|XP_014080900.1| hypothetical protein COCC4DRAFT_21739 [Bipol... 70 8e-10 ref|XP_007695896.1| hypothetical protein COCSADRAFT_167486 [Bipo... 70 8e-10 ref|XP_001931867.1| riboflavin biosynthesis protein ribAB [Pyren... 69 1e-09 ref|XP_008085127.1| YrdC/RibB [Glarea lozoyensis ATCC 20868] gi|... 69 2e-09 ref|XP_003843846.1| similar to 3,4-dihydroxy-2-butanone 4-phosph... 69 2e-09 ref|XP_003295417.1| hypothetical protein PTT_00801 [Pyrenophora ... 69 2e-09 ref|XP_008020863.1| hypothetical protein SETTUDRAFT_162382 [Seto... 68 3e-09 gb|KIN04948.1| hypothetical protein OIDMADRAFT_157456 [Oidiodend... 67 4e-09 gb|EYE97044.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase [As... 67 4e-09 ref|XP_007288982.1| 3,4-dihydroxy-2-butanone 4-phosphate synthas... 67 5e-09 gb|KJK64791.1| 34-dihydroxy-2-butanone 4-phosphate synthase [Asp... 66 1e-08 >gb|EKG13509.1| hypothetical protein MPH_09341 [Macrophomina phaseolina MS6] Length = 244 Score = 94.7 bits (234), Expect = 2e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRLEGVVGVDY 274 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEG+LEGVVGVDY Sbjct: 201 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGKLEGVVGVDY 244 >ref|XP_007585949.1| putative -dihydroxy-2-butanone 4-phosphate synthase protein [Neofusicoccum parvum UCRNP2] gi|485920599|gb|EOD46573.1| putative -dihydroxy-2-butanone 4-phosphate synthase protein [Neofusicoccum parvum UCRNP2] Length = 244 Score = 90.1 bits (222), Expect = 6e-16 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRLEGVVGVDY 274 GMMRRD+CLAFGKR+GIKVCTIED+VRYVEDTEGRLEGVVGVDY Sbjct: 201 GMMRRDDCLAFGKRFGIKVCTIEDMVRYVEDTEGRLEGVVGVDY 244 >gb|KKY26792.1| putative dihydroxy-2-butanone 4-phosphate synthase [Diplodia seriata] Length = 244 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRLEGVVGVDY 274 GMMRRD+CLAFGK++GIKVCTIEDLVRYVEDTEG+LEGVVGVDY Sbjct: 201 GMMRRDDCLAFGKKFGIKVCTIEDLVRYVEDTEGKLEGVVGVDY 244 >ref|XP_007782169.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase [Coniosporium apollinis CBS 100218] gi|494830288|gb|EON66852.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase [Coniosporium apollinis CBS 100218] Length = 242 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRLEGVVGVDY 274 GMMRRD+CLAFGKRWG++VCTIEDLV YVE EG+L GV G DY Sbjct: 200 GMMRRDDCLAFGKRWGLRVCTIEDLVEYVEAKEGKL-GVEGSDY 242 >gb|KFZ15606.1| hypothetical protein V501_02641 [Pseudogymnoascus pannorum VKM F-4519 (FW-2642)] Length = 249 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRLEGVVGVDY 274 GMMRRD+CL FG++WGIKVCTI+DLV YVE+TEG+L+ + GV+Y Sbjct: 207 GMMRRDDCLEFGRKWGIKVCTIDDLVTYVEETEGKLD-IPGVNY 249 >gb|KIW02523.1| 3,4-dihydroxy-2-butanone-4-phosphate synthase [Verruconis gallopava] Length = 253 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRLEGVVGVDY 274 GMMRRD+CL FG+RWG+KVCTIEDLV YVE+ EG+L+ G DY Sbjct: 211 GMMRRDDCLEFGRRWGLKVCTIEDLVAYVEEREGKLD-TPGADY 253 >ref|XP_014552582.1| hypothetical protein COCVIDRAFT_109995 [Bipolaris victoriae FI3] gi|578485512|gb|EUN23007.1| hypothetical protein COCVIDRAFT_109995 [Bipolaris victoriae FI3] Length = 253 Score = 69.7 bits (169), Expect = 8e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRL 298 GMMRRDECL FGK+WGIKVCTIEDLVRY+E+ EG L Sbjct: 214 GMMRRDECLEFGKKWGIKVCTIEDLVRYIEENEGVL 249 >ref|XP_007688974.1| hypothetical protein COCMIDRAFT_6209 [Bipolaris oryzae ATCC 44560] gi|576930939|gb|EUC44510.1| hypothetical protein COCMIDRAFT_6209 [Bipolaris oryzae ATCC 44560] Length = 253 Score = 69.7 bits (169), Expect = 8e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRL 298 GMMRRDECL FGK+WGIKVCTIEDLVRY+E+ EG L Sbjct: 214 GMMRRDECLEFGKKWGIKVCTIEDLVRYIEENEGVL 249 >ref|XP_007713961.1| hypothetical protein COCCADRAFT_100505 [Bipolaris zeicola 26-R-13] gi|576917528|gb|EUC31748.1| hypothetical protein COCCADRAFT_100505 [Bipolaris zeicola 26-R-13] Length = 253 Score = 69.7 bits (169), Expect = 8e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRL 298 GMMRRDECL FGK+WGIKVCTIEDLVRY+E+ EG L Sbjct: 214 GMMRRDECLEFGKKWGIKVCTIEDLVRYIEENEGVL 249 >ref|XP_014080900.1| hypothetical protein COCC4DRAFT_21739 [Bipolaris maydis ATCC 48331] gi|452001100|gb|EMD93560.1| hypothetical protein COCHEDRAFT_1171439 [Bipolaris maydis C5] gi|477589916|gb|ENI06991.1| hypothetical protein COCC4DRAFT_21739 [Bipolaris maydis ATCC 48331] Length = 253 Score = 69.7 bits (169), Expect = 8e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRL 298 GMMRRDECL FGK+WGIKVCTIEDLVRY+E+ EG L Sbjct: 214 GMMRRDECLEFGKKWGIKVCTIEDLVRYIEENEGVL 249 >ref|XP_007695896.1| hypothetical protein COCSADRAFT_167486 [Bipolaris sorokiniana ND90Pr] gi|451854939|gb|EMD68231.1| hypothetical protein COCSADRAFT_167486 [Bipolaris sorokiniana ND90Pr] Length = 253 Score = 69.7 bits (169), Expect = 8e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRL 298 GMMRRDECLAFGK+WGIKVCTIED+V+Y+E+ EG L Sbjct: 214 GMMRRDECLAFGKKWGIKVCTIEDMVKYIEENEGVL 249 >ref|XP_001931867.1| riboflavin biosynthesis protein ribAB [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973473|gb|EDU40972.1| riboflavin biosynthesis protein ribAB [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 256 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRLEGVVGVD 277 GMMRRDECLAFGK+WGIKVCTI+D+VRY+E+ +GV+G D Sbjct: 211 GMMRRDECLAFGKKWGIKVCTIDDMVRYIEEN----DGVLGAD 249 >ref|XP_008085127.1| YrdC/RibB [Glarea lozoyensis ATCC 20868] gi|512198934|gb|EPE27768.1| YrdC/RibB [Glarea lozoyensis ATCC 20868] Length = 234 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRLE 295 GMMRRD+C+AFGKRWG+KVCTIE LV YVE TEG+LE Sbjct: 190 GMMRRDDCVAFGKRWGLKVCTIEALVDYVERTEGKLE 226 >ref|XP_003843846.1| similar to 3,4-dihydroxy-2-butanone 4-phosphate synthase [Leptosphaeria maculans JN3] gi|312220426|emb|CBY00367.1| similar to 3,4-dihydroxy-2-butanone 4-phosphate synthase [Leptosphaeria maculans JN3] Length = 251 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRLE 295 GMMRRDECLAFGKRWGIKVCTIEDL Y+ +TEG L+ Sbjct: 214 GMMRRDECLAFGKRWGIKVCTIEDLCTYIVETEGGLK 250 >ref|XP_003295417.1| hypothetical protein PTT_00801 [Pyrenophora teres f. teres 0-1] gi|311333330|gb|EFQ96494.1| hypothetical protein PTT_00801 [Pyrenophora teres f. teres 0-1] Length = 250 Score = 68.6 bits (166), Expect = 2e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRL 298 GMMRRDECLAFGK+WGIKVCTI+D+VRY+E+ +G L Sbjct: 211 GMMRRDECLAFGKKWGIKVCTIDDMVRYIEENDGVL 246 >ref|XP_008020863.1| hypothetical protein SETTUDRAFT_162382 [Setosphaeria turcica Et28A] gi|482815128|gb|EOA91803.1| hypothetical protein SETTUDRAFT_162382 [Setosphaeria turcica Et28A] Length = 253 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRLEGV 289 GMMRRDECLAFGK+WGIKVCTI+D+V+Y+E EG L V Sbjct: 214 GMMRRDECLAFGKKWGIKVCTIDDMVKYIEANEGVLGAV 252 >gb|KIN04948.1| hypothetical protein OIDMADRAFT_157456 [Oidiodendron maius Zn] Length = 234 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRL 298 GM+RRD CLAFG++WGIKVCTIEDLV YVE TEG+L Sbjct: 192 GMLRRDGCLAFGRKWGIKVCTIEDLVAYVEKTEGKL 227 >gb|EYE97044.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase [Aspergillus ruber CBS 135680] Length = 236 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRL 298 GMMRRD CL FGK+WGIKVCTIEDLV Y+E TEG+L Sbjct: 193 GMMRRDGCLRFGKKWGIKVCTIEDLVEYIERTEGKL 228 >ref|XP_007288982.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867373|gb|EKD20411.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 233 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 402 MMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEGRL 298 MMRRD CLAFGK+WG+KVCTIEDLV YVE TEG+L Sbjct: 191 MMRRDGCLAFGKKWGLKVCTIEDLVEYVEKTEGKL 225 >gb|KJK64791.1| 34-dihydroxy-2-butanone 4-phosphate synthase [Aspergillus parasiticus SU-1] Length = 267 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 405 GMMRRDECLAFGKRWGIKVCTIEDLVRYVEDTEG 304 GMMRRD CL FGK+WGIKVCTIEDLV YVE TEG Sbjct: 224 GMMRRDGCLKFGKKWGIKVCTIEDLVEYVEKTEG 257