BLASTX nr result
ID: Ziziphus21_contig00045648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045648 (409 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001947395.2| PREDICTED: pollen-specific leucine-rich repe... 68 3e-09 >ref|XP_001947395.2| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Acyrthosiphon pisum] Length = 380 Score = 67.8 bits (164), Expect = 3e-09 Identities = 37/72 (51%), Positives = 46/72 (63%) Frame = -1 Query: 232 VSTTPPCSLSFFRYLNNLPGTKVRPPVPEGTVLFNKVLGPPEQYEGSQIDPEEIPAPKEP 53 V T+ PCSLSF+RYL NLPG K+RP VPEGT +F K +GP EG D +P+ +P Sbjct: 23 VQTSTPCSLSFYRYLFNLPGEKIRPNVPEGTYMFGKRVGPATP-EGQASD--NLPSIIKP 79 Query: 52 SASDTNLGYLPP 17 + S YLPP Sbjct: 80 APSYEAPVYLPP 91