BLASTX nr result
ID: Ziziphus21_contig00045575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045575 (242 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG22384.1| hypothetical protein MPH_00281 [Macrophomina phas... 80 5e-13 gb|KKY23652.1| hypothetical protein UCDDS831_g02873 [Diplodia se... 76 1e-11 ref|XP_007582282.1| hypothetical protein UCRNP2_2983 [Neofusicoc... 73 7e-11 >gb|EKG22384.1| hypothetical protein MPH_00281 [Macrophomina phaseolina MS6] Length = 227 Score = 80.5 bits (197), Expect = 5e-13 Identities = 39/51 (76%), Positives = 42/51 (82%) Frame = -1 Query: 230 MATRADVMSTQTEPHRGHKRPASETLDSEQRLSKRFNLLNIDSNGKLYIPV 78 MATR DVMS +EP RGHKR AS+ LD E RLSKRFNLLNID+ GKLYIPV Sbjct: 1 MATRVDVMSMDSEPPRGHKRSASDALDPEHRLSKRFNLLNIDNTGKLYIPV 51 >gb|KKY23652.1| hypothetical protein UCDDS831_g02873 [Diplodia seriata] Length = 217 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 209 MSTQTEPHRGHKRPASETLDSEQRLSKRFNLLNIDSNGKLYIPV 78 MST TEPHRG KR A+E+L+SEQRLSKRFNLLNID++GKLYIPV Sbjct: 1 MSTDTEPHRGLKRAAAESLESEQRLSKRFNLLNIDNSGKLYIPV 44 >ref|XP_007582282.1| hypothetical protein UCRNP2_2983 [Neofusicoccum parvum UCRNP2] gi|485925731|gb|EOD50232.1| hypothetical protein UCRNP2_2983 [Neofusicoccum parvum UCRNP2] Length = 213 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 197 TEPHRGHKRPASETLDSEQRLSKRFNLLNIDSNGKLYIPV 78 TEPHRG KRPA+E L+SEQRLSKRFNLLNIDS GKLYIPV Sbjct: 3 TEPHRGLKRPAAEGLESEQRLSKRFNLLNIDSTGKLYIPV 42