BLASTX nr result
ID: Ziziphus21_contig00045552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045552 (302 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG21515.1| Basic-leucine zipper (bZIP) transcription factor ... 67 7e-09 gb|KKY14506.1| putative regulatory protein cys-3 [Diplodia seriata] 64 4e-08 ref|XP_007587914.1| putative regulatory protein cys-3 protein [N... 60 5e-07 >gb|EKG21515.1| Basic-leucine zipper (bZIP) transcription factor [Macrophomina phaseolina MS6] Length = 294 Score = 66.6 bits (161), Expect = 7e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 105 MSGYAGRRAPNVSQYLQDLNTVPTPQELQQPQQD 4 MSGYA RRAPNVSQY+QDLNTVPTPQELQQPQ + Sbjct: 1 MSGYASRRAPNVSQYIQDLNTVPTPQELQQPQDN 34 >gb|KKY14506.1| putative regulatory protein cys-3 [Diplodia seriata] Length = 288 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 105 MSGYAGRRAPNVSQYLQDLNTVPTPQELQQPQQD 4 MSGYAGR+APNVSQY+QDLNTVPTPQEL QP+ + Sbjct: 1 MSGYAGRKAPNVSQYIQDLNTVPTPQELAQPKDN 34 >ref|XP_007587914.1| putative regulatory protein cys-3 protein [Neofusicoccum parvum UCRNP2] gi|485917807|gb|EOD44631.1| putative regulatory protein cys-3 protein [Neofusicoccum parvum UCRNP2] Length = 287 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 105 MSGYAGRRAPNVSQYLQDLNTVPTPQELQQPQQ 7 MSG+AGRRAPNVSQY+QDLNTVPT QELQ QQ Sbjct: 1 MSGFAGRRAPNVSQYIQDLNTVPTSQELQAQQQ 33