BLASTX nr result
ID: Ziziphus21_contig00045521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045521 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007583197.1| hypothetical protein UCRNP2_3908 [Neofusicoc... 81 3e-13 gb|EKG15253.1| hypothetical protein MPH_07587 [Macrophomina phas... 80 6e-13 gb|KKY13973.1| hypothetical protein UCDDS831_g08518 [Diplodia se... 75 2e-11 >ref|XP_007583197.1| hypothetical protein UCRNP2_3908 [Neofusicoccum parvum UCRNP2] gi|485924549|gb|EOD49333.1| hypothetical protein UCRNP2_3908 [Neofusicoccum parvum UCRNP2] Length = 241 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -3 Query: 323 DVQEEEREAQDKYFDDEDPSWIHSGQGTPKITGETGVQDF 204 DV EEEREAQ+KYFDDEDPSWIHSG TPKITGETGVQDF Sbjct: 202 DVTEEEREAQEKYFDDEDPSWIHSGTATPKITGETGVQDF 241 >gb|EKG15253.1| hypothetical protein MPH_07587 [Macrophomina phaseolina MS6] Length = 244 Score = 80.1 bits (196), Expect = 6e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 323 DVQEEEREAQDKYFDDEDPSWIHSGQGTPKITGETGVQDF 204 DV EEER AQ+KYFDDE+PSWIHSGQGTPKI GETGVQDF Sbjct: 205 DVHEEERAAQEKYFDDEEPSWIHSGQGTPKIAGETGVQDF 244 >gb|KKY13973.1| hypothetical protein UCDDS831_g08518 [Diplodia seriata] Length = 223 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -3 Query: 323 DVQEEEREAQDKYFDDEDPSWIHSGQGTPKITGETGVQDF 204 DVQEEER+ Q++YFD+E+PSWIHSG TP+ITGETGVQDF Sbjct: 184 DVQEEERDTQEQYFDEEEPSWIHSGPATPRITGETGVQDF 223