BLASTX nr result
ID: Ziziphus21_contig00045520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045520 (416 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG20013.1| TB2/DP1/HVA22-related protein [Macrophomina phase... 125 1e-26 ref|XP_007585075.1| putative hva22 domain membrane protein [Neof... 120 3e-25 gb|KKY14305.1| putative hva22 domain membrane protein [Diplodia ... 94 3e-17 ref|XP_007783096.1| hypothetical protein W97_07034 [Coniosporium... 63 1e-07 ref|XP_007686298.1| hypothetical protein COCMIDRAFT_3857 [Bipola... 57 7e-06 ref|XP_014079038.1| hypothetical protein COCC4DRAFT_138490 [Bipo... 57 7e-06 ref|XP_007703288.1| hypothetical protein COCSADRAFT_237278 [Bipo... 57 7e-06 ref|XP_014556172.1| hypothetical protein COCVIDRAFT_38222 [Bipol... 56 9e-06 ref|XP_007708536.1| hypothetical protein COCCADRAFT_23224 [Bipol... 56 9e-06 >gb|EKG20013.1| TB2/DP1/HVA22-related protein [Macrophomina phaseolina MS6] Length = 347 Score = 125 bits (314), Expect = 1e-26 Identities = 68/94 (72%), Positives = 71/94 (75%), Gaps = 5/94 (5%) Frame = -3 Query: 414 SRERSGGGLTKSKSELEFDRVEFDEALEGS-GAPPRMGGRRTTSGGWMPWQWGGAGAPQE 238 SRERSGGGLTKSKSELEFDRVE+DEA+EGS GA PRMGGRRTTSGGWMPWQWG GAPQE Sbjct: 256 SRERSGGGLTKSKSELEFDRVEYDEAIEGSTGASPRMGGRRTTSGGWMPWQWG--GAPQE 313 Query: 237 RG----XXXXXXXXXXXXXXREDRARATANDLAY 148 RG REDR R+TANDLAY Sbjct: 314 RGRLSPQPPSRSRTPSRDASREDRGRSTANDLAY 347 >ref|XP_007585075.1| putative hva22 domain membrane protein [Neofusicoccum parvum UCRNP2] gi|485921851|gb|EOD47475.1| putative hva22 domain membrane protein [Neofusicoccum parvum UCRNP2] Length = 344 Score = 120 bits (302), Expect = 3e-25 Identities = 61/89 (68%), Positives = 64/89 (71%) Frame = -3 Query: 414 SRERSGGGLTKSKSELEFDRVEFDEALEGSGAPPRMGGRRTTSGGWMPWQWGGAGAPQER 235 SRER G GLTKSKSELEFDRVE+DEALEG G P R GGRRTTSGGWMPWQW GAG Q+ Sbjct: 257 SRERRGDGLTKSKSELEFDRVEYDEALEGPGGPARQGGRRTTSGGWMPWQW-GAGGQQQE 315 Query: 234 GXXXXXXXXXXXXXXREDRARATANDLAY 148 G REDR RAT+NDLAY Sbjct: 316 GRLSPQPPSRSRTPSREDRGRATSNDLAY 344 >gb|KKY14305.1| putative hva22 domain membrane protein [Diplodia seriata] Length = 352 Score = 94.4 bits (233), Expect = 3e-17 Identities = 56/96 (58%), Positives = 61/96 (63%), Gaps = 7/96 (7%) Frame = -3 Query: 414 SRERSGGG-LTKSKSELEFDRVEFDEALEGSGAPP-----RMGGRRTTSGGWMPWQWGGA 253 SRERSG G LTKSKSELEFDRVE+DEA EG+ + R GG RTTSGGWMPWQWG Sbjct: 259 SRERSGAGSLTKSKSELEFDRVEYDEAFEGASSSGGSGRGRPGGSRTTSGGWMPWQWG-- 316 Query: 252 GAPQERG-XXXXXXXXXXXXXXREDRARATANDLAY 148 PQE+G RE R RAT +DLAY Sbjct: 317 AQPQEKGRLSPQPPSSRSRTPSRESRGRATGSDLAY 352 >ref|XP_007783096.1| hypothetical protein W97_07034 [Coniosporium apollinis CBS 100218] gi|494831299|gb|EON67779.1| hypothetical protein W97_07034 [Coniosporium apollinis CBS 100218] Length = 321 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/55 (52%), Positives = 34/55 (61%) Frame = -3 Query: 408 ERSGGGLTKSKSELEFDRVEFDEALEGSGAPPRMGGRRTTSGGWMPWQWGGAGAP 244 ER G+ KS+SEL+FD++E DEA EG G RT SGGWMPW WG P Sbjct: 251 ERRTEGMAKSRSELDFDKIERDEAAEGRR------GSRTASGGWMPWNWGARAVP 299 >ref|XP_007686298.1| hypothetical protein COCMIDRAFT_3857 [Bipolaris oryzae ATCC 44560] gi|576933622|gb|EUC47146.1| hypothetical protein COCMIDRAFT_3857 [Bipolaris oryzae ATCC 44560] Length = 342 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/62 (46%), Positives = 36/62 (58%), Gaps = 6/62 (9%) Frame = -3 Query: 405 RSGGGLTKSKSELEFDRVEFDEALEGSG------APPRMGGRRTTSGGWMPWQWGGAGAP 244 RS G L++++SE EFDR+E DE GS PP +G R TS GWMPW W A Sbjct: 257 RSSGSLSRNRSEAEFDRIERDELSSGSDRPPYPITPPALG--RRTSSGWMPWNWQRQEAS 314 Query: 243 QE 238 Q+ Sbjct: 315 QD 316 >ref|XP_014079038.1| hypothetical protein COCC4DRAFT_138490 [Bipolaris maydis ATCC 48331] gi|451996685|gb|EMD89151.1| hypothetical protein COCHEDRAFT_12350 [Bipolaris maydis C5] gi|477588049|gb|ENI05129.1| hypothetical protein COCC4DRAFT_138490 [Bipolaris maydis ATCC 48331] Length = 342 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/62 (46%), Positives = 36/62 (58%), Gaps = 6/62 (9%) Frame = -3 Query: 405 RSGGGLTKSKSELEFDRVEFDEALEGSG------APPRMGGRRTTSGGWMPWQWGGAGAP 244 RS G L++++SE EFDR+E DE GS PP +G R TS GWMPW W A Sbjct: 257 RSSGSLSRNRSEAEFDRIERDELSSGSDRPPYPITPPALG--RRTSSGWMPWNWQRQEAS 314 Query: 243 QE 238 Q+ Sbjct: 315 QD 316 >ref|XP_007703288.1| hypothetical protein COCSADRAFT_237278 [Bipolaris sorokiniana ND90Pr] gi|451847615|gb|EMD60922.1| hypothetical protein COCSADRAFT_237278 [Bipolaris sorokiniana ND90Pr] Length = 342 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/62 (46%), Positives = 36/62 (58%), Gaps = 6/62 (9%) Frame = -3 Query: 405 RSGGGLTKSKSELEFDRVEFDEALEGSG------APPRMGGRRTTSGGWMPWQWGGAGAP 244 RS G L++++SE EFDR+E DE GS PP +G R TS GWMPW W A Sbjct: 257 RSSGSLSRNRSEAEFDRIERDELSSGSDRPPYPITPPALG--RRTSSGWMPWNWQRQEAS 314 Query: 243 QE 238 Q+ Sbjct: 315 QD 316 >ref|XP_014556172.1| hypothetical protein COCVIDRAFT_38222 [Bipolaris victoriae FI3] gi|578489158|gb|EUN26594.1| hypothetical protein COCVIDRAFT_38222 [Bipolaris victoriae FI3] Length = 342 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/62 (46%), Positives = 36/62 (58%), Gaps = 6/62 (9%) Frame = -3 Query: 405 RSGGGLTKSKSELEFDRVEFDEALEGSG------APPRMGGRRTTSGGWMPWQWGGAGAP 244 RS G L++++SE EFDR+E DE GS PP +G R TS GWMPW W A Sbjct: 257 RSSGSLSRNRSEAEFDRIERDELSSGSDRPPYPITPPPLG--RRTSSGWMPWNWQRQEAS 314 Query: 243 QE 238 Q+ Sbjct: 315 QD 316 >ref|XP_007708536.1| hypothetical protein COCCADRAFT_23224 [Bipolaris zeicola 26-R-13] gi|576923024|gb|EUC37146.1| hypothetical protein COCCADRAFT_23224 [Bipolaris zeicola 26-R-13] Length = 342 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/62 (46%), Positives = 36/62 (58%), Gaps = 6/62 (9%) Frame = -3 Query: 405 RSGGGLTKSKSELEFDRVEFDEALEGSG------APPRMGGRRTTSGGWMPWQWGGAGAP 244 RS G L++++SE EFDR+E DE GS PP +G R TS GWMPW W A Sbjct: 257 RSSGSLSRNRSEAEFDRIERDELSSGSDRPPYPITPPPLG--RRTSSGWMPWNWQRQEAS 314 Query: 243 QE 238 Q+ Sbjct: 315 QD 316