BLASTX nr result
ID: Ziziphus21_contig00045501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00045501 (399 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EHA28068.1| hypothetical protein ASPNIDRAFT_185082 [Aspergill... 74 6e-11 ref|XP_001401327.1| Zn(II)2Cys6 transcription factor [Aspergillu... 74 6e-11 gb|KNG91178.1| putative C6 finger domain protein [Aspergillus no... 71 4e-10 ref|XP_002384736.1| C6 finger domain protein, putative [Aspergil... 69 1e-09 emb|CRK46602.1| hypothetical protein BN1723_007160 [Verticillium... 67 4e-09 emb|CRK10527.1| hypothetical protein BN1708_009935 [Verticillium... 67 4e-09 dbj|GAA90430.1| C6 transcription factor [Aspergillus kawachii IF... 67 4e-09 dbj|GAQ08694.1| hypothetical protein ALT_6015 [Aspergillus lentu... 67 5e-09 ref|XP_001827524.1| Zn(II)2Cys6 transcription factor [Aspergillu... 67 5e-09 tpe|CBF86646.1| TPA: Putative Zn(II)2Cys6 transcription factor (... 67 5e-09 gb|KKK13205.1| hypothetical protein ARAM_000547 [Aspergillus ram... 66 9e-09 gb|EHA24758.1| hypothetical protein ASPNIDRAFT_200732 [Aspergill... 66 9e-09 ref|XP_001397041.1| C6 transcription factor [Aspergillus niger C... 66 9e-09 gb|EYE90793.1| hypothetical protein EURHEDRAFT_466396 [Aspergill... 66 1e-08 ref|XP_007588576.1| putative c6 transcription protein [Neofusico... 66 1e-08 tpe|CBF78855.1| TPA: Putative Zn(II)2Cys6 transcription factor (... 65 2e-08 gb|KKY21019.1| putative c6 transcription [Diplodia seriata] 65 2e-08 gb|EYE90415.1| hypothetical protein EURHEDRAFT_527064 [Aspergill... 64 3e-08 gb|KEY83309.1| transcription factor C6 [Aspergillus fumigatus va... 64 4e-08 gb|KEY77777.1| transcription factor C6 [Aspergillus fumigatus va... 64 4e-08 >gb|EHA28068.1| hypothetical protein ASPNIDRAFT_185082 [Aspergillus niger ATCC 1015] Length = 408 Score = 73.6 bits (179), Expect = 6e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 330 GCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFASLSPFNTPD 208 GCQNCK+RR+KCDEKKP CT C RHSI CDFAS + +PD Sbjct: 15 GCQNCKKRRVKCDEKKPQCTKCVRHSIECDFASPASSTSPD 55 >ref|XP_001401327.1| Zn(II)2Cys6 transcription factor [Aspergillus niger CBS 513.88] gi|134082012|emb|CAK46697.1| unnamed protein product [Aspergillus niger] Length = 419 Score = 73.6 bits (179), Expect = 6e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 330 GCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFASLSPFNTPD 208 GCQNCK+RR+KCDEKKP CT C RHSI CDFAS + +PD Sbjct: 21 GCQNCKKRRVKCDEKKPQCTKCVRHSIECDFASPASSTSPD 61 >gb|KNG91178.1| putative C6 finger domain protein [Aspergillus nomius NRRL 13137] Length = 420 Score = 70.9 bits (172), Expect = 4e-10 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFASLSP 223 LGC+NCKRRR+KCDEK+PSCTNC HSI CDF+ +P Sbjct: 20 LGCKNCKRRRVKCDEKRPSCTNCVNHSIECDFSVSTP 56 >ref|XP_002384736.1| C6 finger domain protein, putative [Aspergillus flavus NRRL3357] gi|220689449|gb|EED45800.1| C6 finger domain protein, putative [Aspergillus flavus NRRL3357] Length = 419 Score = 69.3 bits (168), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFASLSP 223 LGC+NCKRRR+KCDEKKPSC NC HSI CDF+ +P Sbjct: 20 LGCKNCKRRRVKCDEKKPSCGNCVNHSIECDFSVSTP 56 >emb|CRK46602.1| hypothetical protein BN1723_007160 [Verticillium longisporum] Length = 466 Score = 67.4 bits (163), Expect = 4e-09 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = -1 Query: 330 GCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFASLSPFNTPDV 205 GC NCKRR++KCDE +PSC NC RH +RC F P+ TP++ Sbjct: 50 GCANCKRRKVKCDESRPSCRNCHRHGVRCSFVDDKPWTTPEL 91 >emb|CRK10527.1| hypothetical protein BN1708_009935 [Verticillium longisporum] Length = 466 Score = 67.4 bits (163), Expect = 4e-09 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = -1 Query: 330 GCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFASLSPFNTPDV 205 GC NCKRR++KCDE +PSC NC RH +RC F P+ TP++ Sbjct: 50 GCANCKRRKVKCDESRPSCRNCHRHGVRCSFVDDKPWTTPEL 91 >dbj|GAA90430.1| C6 transcription factor [Aspergillus kawachii IFO 4308] Length = 464 Score = 67.4 bits (163), Expect = 4e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFAS 232 LGC+NCKRRR+KCDE KP CTNC RHSI CD++S Sbjct: 22 LGCKNCKRRRVKCDEIKPHCTNCLRHSIECDYSS 55 >dbj|GAQ08694.1| hypothetical protein ALT_6015 [Aspergillus lentulus] Length = 445 Score = 67.0 bits (162), Expect = 5e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFA 235 LGCQNCKRRR+KCDE KPSC NC RHS+ CD+A Sbjct: 22 LGCQNCKRRRVKCDEVKPSCGNCLRHSVDCDYA 54 >ref|XP_001827524.1| Zn(II)2Cys6 transcription factor [Aspergillus oryzae RIB40] gi|83776272|dbj|BAE66391.1| unnamed protein product [Aspergillus oryzae RIB40] gi|391866349|gb|EIT75621.1| Zn(II)2Cys6 transcription factor [Aspergillus oryzae 3.042] gi|635514340|gb|KDE86091.1| Zn2Cys6 transcription factor [Aspergillus oryzae 100-8] Length = 419 Score = 67.0 bits (162), Expect = 5e-09 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFASLSP 223 LGC+NCKRRR+KCDEKKPSC C HSI CDF+ +P Sbjct: 20 LGCKNCKRRRVKCDEKKPSCGKCVNHSIECDFSVSTP 56 >tpe|CBF86646.1| TPA: Putative Zn(II)2Cys6 transcription factor (Eurofung) [Aspergillus nidulans FGSC A4] Length = 421 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 3/40 (7%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDF---ASLSP 223 LGC NCKRRR+KCDEKKP CTNC +HSI CDF AS SP Sbjct: 21 LGCGNCKRRRVKCDEKKPMCTNCVQHSIDCDFRLSASGSP 60 >gb|KKK13205.1| hypothetical protein ARAM_000547 [Aspergillus rambellii] gi|816346712|gb|KKK22835.1| hypothetical protein AOCH_003839 [Aspergillus ochraceoroseus] Length = 418 Score = 66.2 bits (160), Expect = 9e-09 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFAS 232 LGC+NCK+RRIKCDE+KP+C+NC HSI CDF+S Sbjct: 21 LGCENCKKRRIKCDEQKPACSNCLHHSIDCDFSS 54 >gb|EHA24758.1| hypothetical protein ASPNIDRAFT_200732 [Aspergillus niger ATCC 1015] Length = 451 Score = 66.2 bits (160), Expect = 9e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFA 235 LGC+NCKRRRIKCDE KP CTNC RHSI CD++ Sbjct: 22 LGCKNCKRRRIKCDEIKPHCTNCLRHSIECDYS 54 >ref|XP_001397041.1| C6 transcription factor [Aspergillus niger CBS 513.88] gi|134082569|emb|CAK42484.1| unnamed protein product [Aspergillus niger] Length = 466 Score = 66.2 bits (160), Expect = 9e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFA 235 LGC+NCKRRRIKCDE KP CTNC RHSI CD++ Sbjct: 22 LGCKNCKRRRIKCDEIKPHCTNCLRHSIECDYS 54 >gb|EYE90793.1| hypothetical protein EURHEDRAFT_466396 [Aspergillus ruber CBS 135680] Length = 431 Score = 65.9 bits (159), Expect = 1e-08 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFASLSP 223 LGC+NCK+RRIKCDEKKP+C+NC H I CDF + P Sbjct: 17 LGCRNCKKRRIKCDEKKPACSNCQHHGISCDFTASLP 53 >ref|XP_007588576.1| putative c6 transcription protein [Neofusicoccum parvum UCRNP2] gi|485916753|gb|EOD43952.1| putative c6 transcription protein [Neofusicoccum parvum UCRNP2] Length = 410 Score = 65.9 bits (159), Expect = 1e-08 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = -1 Query: 330 GCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFASLSPFNTP 211 GC NCKRR+IKCDE KP C NC +H IRCD+ +P TP Sbjct: 15 GCANCKRRKIKCDESKPECGNCVKHRIRCDYMDAAPSATP 54 >tpe|CBF78855.1| TPA: Putative Zn(II)2Cys6 transcription factor (Eurofung) [Aspergillus nidulans FGSC A4] Length = 448 Score = 65.5 bits (158), Expect = 2e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDF 238 LGC NCKRRRIKCDEKKP C+NC RHS+ CD+ Sbjct: 23 LGCGNCKRRRIKCDEKKPECSNCLRHSVYCDY 54 >gb|KKY21019.1| putative c6 transcription [Diplodia seriata] Length = 434 Score = 65.1 bits (157), Expect = 2e-08 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = -1 Query: 330 GCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFASLSPFNTP 211 GC NCKRR++KCDE KP C NC +H IRCD+ +P TP Sbjct: 15 GCTNCKRRKVKCDEVKPECGNCVKHRIRCDYLDSTPATTP 54 >gb|EYE90415.1| hypothetical protein EURHEDRAFT_527064 [Aspergillus ruber CBS 135680] Length = 447 Score = 64.3 bits (155), Expect = 3e-08 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFAS 232 LGC NCKRRR+KC+E KP+CTNC RHSI CD+ S Sbjct: 22 LGCGNCKRRRVKCNEAKPACTNCLRHSIDCDYQS 55 >gb|KEY83309.1| transcription factor C6 [Aspergillus fumigatus var. RP-2014] Length = 415 Score = 63.9 bits (154), Expect = 4e-08 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDFASLS 226 LGC+ CK+RR+KCDEKKP+CTNC +H++ CD+A+ S Sbjct: 20 LGCKTCKKRRVKCDEKKPTCTNCRQHAVICDYATES 55 >gb|KEY77777.1| transcription factor C6 [Aspergillus fumigatus var. RP-2014] Length = 443 Score = 63.9 bits (154), Expect = 4e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 333 LGCQNCKRRRIKCDEKKPSCTNCTRHSIRCDF 238 LGC+NCKRRR+KCDE KP+C NC RHSI CD+ Sbjct: 22 LGCRNCKRRRVKCDEVKPNCGNCLRHSIECDY 53