BLASTX nr result
ID: Ziziphus21_contig00043940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00043940 (282 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007912684.1| putative zinc finger protein [Togninia minim... 62 1e-07 emb|CCF32932.1| zinc finger protein [Colletotrichum higginsianum] 62 2e-07 dbj|GAM89300.1| hypothetical protein ANO11243_073370 [fungal sp.... 61 3e-07 ref|XP_007784270.1| hypothetical protein W97_08211 [Coniosporium... 60 5e-07 gb|ENH83759.1| C2H2 finger domain-containing protein [Colletotri... 60 8e-07 gb|KNG47533.1| zinc finger containing protein [Stemphylium lycop... 59 1e-06 gb|KJY02246.1| c2h2 finger domain containing protein [Zymoseptor... 59 1e-06 ref|XP_007714933.1| hypothetical protein COCCADRAFT_39051 [Bipol... 59 1e-06 ref|XP_008094516.1| zinc finger containing protein [Colletotrich... 59 1e-06 gb|KDN62854.1| putative zinc finger containing protein [Colletot... 59 2e-06 ref|XP_007691733.1| hypothetical protein COCMIDRAFT_40113 [Bipol... 59 2e-06 ref|XP_008022834.1| hypothetical protein SETTUDRAFT_167665 [Seto... 59 2e-06 ref|XP_014075236.1| hypothetical protein COCC4DRAFT_204002 [Bipo... 59 2e-06 ref|XP_014169219.1| c2h2 finger domain containing protein [Grosm... 59 2e-06 gb|KKK21168.1| C2H2 finger domain protein [Aspergillus ochraceor... 58 2e-06 gb|EEH09147.1| conserved hypothetical protein [Histoplasma capsu... 58 2e-06 gb|EQB54228.1| hypothetical protein CGLO_05953 [Colletotrichum g... 58 2e-06 ref|XP_003716399.1| zinc finger protein [Magnaporthe oryzae 70-1... 58 2e-06 ref|XP_663130.1| hypothetical protein AN5526.2 [Aspergillus nidu... 58 3e-06 ref|XP_007672730.1| hypothetical protein BAUCODRAFT_59233, parti... 58 3e-06 >ref|XP_007912684.1| putative zinc finger protein [Togninia minima UCRPA7] gi|500259816|gb|EOO02578.1| putative zinc finger protein [Phaeoacremonium minimum UCRPA7] Length = 114 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/44 (68%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNG--TRTNSADRT 155 RGKPHKR L+QLREEP+T KE++AA+GLRTDNG +T S D T Sbjct: 69 RGKPHKRRLKQLREEPYTHKEADAAVGLRTDNGRPEKTESEDVT 112 >emb|CCF32932.1| zinc finger protein [Colletotrichum higginsianum] Length = 121 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNSADRTGLSTAVE 134 RGKPHKR ++QL+EEP+TQK++EAAIGLRTDN N L +E Sbjct: 70 RGKPHKRRVKQLKEEPYTQKDAEAAIGLRTDNKGANNDGPEKALDQEIE 118 >dbj|GAM89300.1| hypothetical protein ANO11243_073370 [fungal sp. No.11243] Length = 119 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNSA 164 +GKPHK+ +RQL+EEP+TQKE+EAA GL TDNG R N+A Sbjct: 71 KGKPHKKRVRQLKEEPYTQKEAEAAAGLFTDNGKRLNTA 109 >ref|XP_007784270.1| hypothetical protein W97_08211 [Coniosporium apollinis CBS 100218] gi|494832787|gb|EON68953.1| hypothetical protein W97_08211 [Coniosporium apollinis CBS 100218] Length = 118 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNSA 164 RGK HKR LRQLR+EP TQKE++AA+GL TDNG RT S+ Sbjct: 71 RGKVHKRRLRQLRDEPWTQKEADAAVGLGTDNGKRTTSS 109 >gb|ENH83759.1| C2H2 finger domain-containing protein [Colletotrichum orbiculare MAFF 240422] Length = 125 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/42 (66%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDN-GTRTNSADR 158 RGKPHKR ++QL+EEP+TQKE+EA IGLRTDN G N +R Sbjct: 74 RGKPHKRRVKQLKEEPYTQKEAEAVIGLRTDNKGPNRNGLER 115 >gb|KNG47533.1| zinc finger containing protein [Stemphylium lycopersici] Length = 121 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNS 167 +GK HKR ++QLREEP++QKE+EAAIGL T+NGTRT + Sbjct: 71 KGKVHKRRVKQLREEPYSQKEAEAAIGLTTNNGTRTTA 108 >gb|KJY02246.1| c2h2 finger domain containing protein [Zymoseptoria brevis] Length = 121 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/40 (60%), Positives = 34/40 (85%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNSAD 161 +GKPHK+ ++Q++EEP++QKE+EAA+GL TDNG R AD Sbjct: 71 KGKPHKKRVKQMKEEPYSQKEAEAAVGLTTDNGRRAVEAD 110 >ref|XP_007714933.1| hypothetical protein COCCADRAFT_39051 [Bipolaris zeicola 26-R-13] gi|953418397|ref|XP_014551270.1| hypothetical protein COCVIDRAFT_113341 [Bipolaris victoriae FI3] gi|576916518|gb|EUC30774.1| hypothetical protein COCCADRAFT_39051 [Bipolaris zeicola 26-R-13] gi|578484159|gb|EUN21694.1| hypothetical protein COCVIDRAFT_113341 [Bipolaris victoriae FI3] Length = 121 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNS 167 +GK HKR ++QLREEP++QKE+EAAIGL T+NGTRT + Sbjct: 71 KGKVHKRRVKQLREEPYSQKEAEAAIGLTTNNGTRTTA 108 >ref|XP_008094516.1| zinc finger containing protein [Colletotrichum graminicola M1.001] gi|310795035|gb|EFQ30496.1| zinc finger containing protein [Colletotrichum graminicola M1.001] Length = 121 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/56 (50%), Positives = 40/56 (71%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNSADRTGLSTAVESMVVEET 113 RGKPHKR ++QL+EEP+TQK++EAA+GLRTDN ++ G A++ + ET Sbjct: 70 RGKPHKRRVKQLKEEPYTQKDAEAAVGLRTDN----RGVNKDGPEKALDQEIDMET 121 >gb|KDN62854.1| putative zinc finger containing protein [Colletotrichum sublineola] Length = 121 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/49 (53%), Positives = 34/49 (69%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNSADRTGLSTAVE 134 RGKPHKR ++QL+EEP+TQK++EAA+GLRTDN L +E Sbjct: 70 RGKPHKRRVKQLKEEPYTQKDAEAAVGLRTDNKGFNKDGPEKALDQEIE 118 >ref|XP_007691733.1| hypothetical protein COCMIDRAFT_40113 [Bipolaris oryzae ATCC 44560] gi|576928083|gb|EUC41739.1| hypothetical protein COCMIDRAFT_40113 [Bipolaris oryzae ATCC 44560] Length = 121 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRT 173 +GK HKR ++QLREEP++QKE+EAAIGL T+NGTRT Sbjct: 71 KGKVHKRRVKQLREEPYSQKEAEAAIGLTTNNGTRT 106 >ref|XP_008022834.1| hypothetical protein SETTUDRAFT_167665 [Setosphaeria turcica Et28A] gi|482813253|gb|EOA89957.1| hypothetical protein SETTUDRAFT_167665 [Setosphaeria turcica Et28A] Length = 122 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRT 173 +GK HKR ++QLREEP++QKE+EAAIGL T+NGTRT Sbjct: 71 KGKVHKRRVKQLREEPYSQKEAEAAIGLTTNNGTRT 106 >ref|XP_014075236.1| hypothetical protein COCC4DRAFT_204002 [Bipolaris maydis ATCC 48331] gi|452005079|gb|EMD97535.1| hypothetical protein COCHEDRAFT_1200215 [Bipolaris maydis C5] gi|477584234|gb|ENI01327.1| hypothetical protein COCC4DRAFT_204002 [Bipolaris maydis ATCC 48331] Length = 121 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNS 167 +GK HKR ++QLREEP++QKE+EAA+GL T+NGTRT + Sbjct: 71 KGKVHKRRVKQLREEPYSQKEAEAAVGLTTNNGTRTTA 108 >ref|XP_014169219.1| c2h2 finger domain containing protein [Grosmannia clavigera kw1407] gi|320587324|gb|EFW99804.1| c2h2 finger domain containing protein [Grosmannia clavigera kw1407] Length = 127 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNSA 164 RGKPH+R ++QL E P+TQKE+EAAIGLRTDNG T A Sbjct: 70 RGKPHRRRVKQLTEVPYTQKEAEAAIGLRTDNGESTVDA 108 >gb|KKK21168.1| C2H2 finger domain protein [Aspergillus ochraceoroseus] Length = 111 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNSAD 161 +GK HKR LR LREEP+TQK +EAA+GL TDNG R AD Sbjct: 67 KGKNHKRRLRLLREEPYTQKSAEAAVGLGTDNGIRPKEAD 106 >gb|EEH09147.1| conserved hypothetical protein [Histoplasma capsulatum G186AR] gi|240280585|gb|EER44089.1| C2H2 finger domain-containing protein [Histoplasma capsulatum H143] gi|325089153|gb|EGC42463.1| C2H2 finger domain-containing protein [Histoplasma capsulatum H88] Length = 115 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/49 (61%), Positives = 34/49 (69%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNSADRTGLSTAVE 134 RGK HKR LR L+EEPH+QK +EAAIGL TDNGTR A S +E Sbjct: 67 RGKNHKRRLRILKEEPHSQKMAEAAIGLGTDNGTRAVQAMDVAESEMIE 115 >gb|EQB54228.1| hypothetical protein CGLO_05953 [Colletotrichum gloeosporioides Cg-14] Length = 121 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/56 (51%), Positives = 38/56 (67%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNSADRTGLSTAVESMVVEET 113 +GKPHKR ++QL+EEP+TQKE+EA +GLRTDN + G AV+ V ET Sbjct: 70 KGKPHKRRVKQLKEEPYTQKEAEAVVGLRTDN----KGPSKGGPERAVDQEVEMET 121 >ref|XP_003716399.1| zinc finger protein [Magnaporthe oryzae 70-15] gi|351642218|gb|EHA50080.1| zinc finger protein [Magnaporthe oryzae 70-15] gi|440466883|gb|ELQ36126.1| zinc finger protein [Magnaporthe oryzae Y34] gi|440479870|gb|ELQ60607.1| zinc finger protein [Magnaporthe oryzae P131] Length = 115 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDN 185 +GKPHKR ++QL+EEP+TQKE+EAAIGLRTDN Sbjct: 70 KGKPHKRRVKQLQEEPYTQKEAEAAIGLRTDN 101 >ref|XP_663130.1| hypothetical protein AN5526.2 [Aspergillus nidulans FGSC A4] gi|40743496|gb|EAA62686.1| hypothetical protein AN5526.2 [Aspergillus nidulans FGSC A4] gi|259485022|tpe|CBF81739.1| TPA: C2H2 finger domain protein, putative (AFU_orthologue; AFUA_6G12920) [Aspergillus nidulans FGSC A4] Length = 115 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNGTRTNSADRTGLST 143 +GK HKR LR LREEPH+QK +EAA+GL TDNG R +D + + Sbjct: 70 KGKNHKRRLRLLREEPHSQKIAEAAVGLTTDNGPRRGDSDEMAMDS 115 >ref|XP_007672730.1| hypothetical protein BAUCODRAFT_59233, partial [Baudoinia panamericana UAMH 10762] gi|449304222|gb|EMD00230.1| hypothetical protein BAUCODRAFT_59233, partial [Baudoinia panamericana UAMH 10762] Length = 104 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = -3 Query: 280 RGKPHKRMLRQLREEPHTQKESEAAIGLRTDNG 182 +GKPHKR LRQL++EP++QKE+EAA+GL TDNG Sbjct: 71 KGKPHKRRLRQLKDEPYSQKEAEAAVGLTTDNG 103