BLASTX nr result
ID: Ziziphus21_contig00043862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00043862 (293 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABM55640.1| putative ubiquinol-cytochrome c reductase, Rieske... 77 6e-12 >gb|ABM55640.1| putative ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 [Maconellicoccus hirsutus] Length = 276 Score = 76.6 bits (187), Expect = 6e-12 Identities = 38/56 (67%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -1 Query: 167 MLSVVQKAPNLANTLKATSYVVPNITAPPKVVAP-KHEVASVYVPEQYLTVDKLKS 3 MLSVVQKAPNL+N LKAT+YVVPNI PP +P HEV SV+VPE Y+T K+KS Sbjct: 1 MLSVVQKAPNLSNALKATTYVVPNIATPPTTSSPIHHEVPSVHVPETYITASKMKS 56