BLASTX nr result
ID: Ziziphus21_contig00043802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00043802 (294 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG11959.1| Glutaredoxin, partial [Macrophomina phaseolina MS6] 67 4e-09 >gb|EKG11959.1| Glutaredoxin, partial [Macrophomina phaseolina MS6] Length = 372 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 293 TLAPQDDNTPRVSTDISREKGFDEPSFNNSNQEGDN 186 TLAPQD NTP+VSTDISREKGFD P+F+NSN EGDN Sbjct: 327 TLAPQDTNTPKVSTDISREKGFDAPAFDNSNHEGDN 362