BLASTX nr result
ID: Ziziphus21_contig00043549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00043549 (407 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ59644.1| hypothetical protein M437DRAFT_56283 [Aureobasidi... 58 3e-06 >gb|KEQ59644.1| hypothetical protein M437DRAFT_56283 [Aureobasidium melanogenum CBS 110374] Length = 135 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -1 Query: 278 SGLERPGKRRECPVPKPGGLVGQILGFEDQ-QRVRRTVIVESVRSSRTAHAKEDGES 111 S +ERP +RECPVPKP GL+GQ++GF+ Q QR T+I++++R T E G++ Sbjct: 79 SDMERP--KRECPVPKPSGLIGQVMGFKPQEQRQNPTIIIQTLRDRHTRQDTESGDN 133