BLASTX nr result
ID: Ziziphus21_contig00043523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00043523 (305 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG14804.1| hypothetical protein MPH_08079 [Macrophomina phas... 138 1e-30 ref|XP_007583230.1| putative rho gtpase activator protein [Neofu... 82 1e-13 >gb|EKG14804.1| hypothetical protein MPH_08079 [Macrophomina phaseolina MS6] Length = 649 Score = 138 bits (348), Expect = 1e-30 Identities = 69/101 (68%), Positives = 77/101 (76%) Frame = -3 Query: 303 SLSLNLHEPNKGYPQPQNGDXXXXXXXXXXXXXXXXXRNEMSRNERNMDSYARSNSSNSH 124 SLSLNLH+PNKG+PQPQNGD RNEM RNERNMDSYA SNSSNSH Sbjct: 6 SLSLNLHQPNKGHPQPQNGDNPRSPQSPRSPGSSQASRNEMIRNERNMDSYAASNSSNSH 65 Query: 123 TGPERSPKAHAIKEETSKALFSNSKASKSTTRVGGGENQMS 1 +GPERSPKAH +KE+ K+LFSNSKASKS TR+G G+NQMS Sbjct: 66 SGPERSPKAHPVKEDAPKSLFSNSKASKSMTRIGCGDNQMS 106 >ref|XP_007583230.1| putative rho gtpase activator protein [Neofusicoccum parvum UCRNP2] gi|485924522|gb|EOD49319.1| putative rho gtpase activator protein [Neofusicoccum parvum UCRNP2] Length = 601 Score = 82.4 bits (202), Expect = 1e-13 Identities = 44/58 (75%), Positives = 48/58 (82%), Gaps = 4/58 (6%) Frame = -3 Query: 162 MDSYARSNSSNS---HTGPERSPKAHAIKEETSKALFSNSKASKSTTRVGGGE-NQMS 1 MDSYA SNSSNS HTGPERSPK H KEET K+LF+NSKASKS+TRVGGG+ N MS Sbjct: 1 MDSYAASNSSNSSKPHTGPERSPKTHPAKEETPKSLFANSKASKSSTRVGGGDSNAMS 58