BLASTX nr result
ID: Ziziphus21_contig00043388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00043388 (212 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG10733.1| Peptidase C54 [Macrophomina phaseolina MS6] 70 6e-10 ref|XP_007584398.1| putative cysteine protease atg4 protein [Neo... 58 2e-06 >gb|EKG10733.1| Peptidase C54 [Macrophomina phaseolina MS6] Length = 437 Score = 70.1 bits (170), Expect = 6e-10 Identities = 35/76 (46%), Positives = 44/76 (57%), Gaps = 6/76 (7%) Frame = -2 Query: 211 PASQDEAAPSSAQPLXXXXXXXXXXXXXXXXS------EDGSPPTTDDTSNPDADSGWPS 50 P+ +D+ AP+ +QPL ED S PT DD S+ DA+ GWPS Sbjct: 44 PSFKDDPAPTPSQPLSVSHGSTASSRSATGDRTSQNSSEDDSLPTVDDASDSDANGGWPS 103 Query: 49 PFVDDFEARVWLTYRS 2 PF+DDFEARVW+TYRS Sbjct: 104 PFLDDFEARVWITYRS 119 >ref|XP_007584398.1| putative cysteine protease atg4 protein [Neofusicoccum parvum UCRNP2] gi|485922821|gb|EOD48149.1| putative cysteine protease atg4 protein [Neofusicoccum parvum UCRNP2] Length = 239 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 91 DDTSNPDADSGWPSPFVDDFEARVWLTYRS 2 DD S+ DAD GWP+PF++DFEARVWLTYRS Sbjct: 90 DDASDADADGGWPAPFLEDFEARVWLTYRS 119