BLASTX nr result
ID: Ziziphus21_contig00043370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00043370 (270 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG15656.1| hypothetical protein MPH_07091 [Macrophomina phas... 155 9e-36 >gb|EKG15656.1| hypothetical protein MPH_07091 [Macrophomina phaseolina MS6] Length = 905 Score = 155 bits (393), Expect = 9e-36 Identities = 78/90 (86%), Positives = 79/90 (87%) Frame = -1 Query: 270 PQFSILARPHPEVSATPSPKHTPAAPVQRRDTNSPRNVVEAPKPFAPQFTPQILRRPQNA 91 PQFSILAR E ATPSPKH AAP QRR+TNSPRNVVEAPKPFAP FTPQILRRPQNA Sbjct: 732 PQFSILARSRHEAVATPSPKHAAAAPAQRRNTNSPRNVVEAPKPFAPHFTPQILRRPQNA 791 Query: 90 VSPSPSRLPSHSFDRRESASSDQKTALLSL 1 VSPSPSR PSHS DRRESASSDQKTALLSL Sbjct: 792 VSPSPSRAPSHSLDRRESASSDQKTALLSL 821