BLASTX nr result
ID: Ziziphus21_contig00043350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00043350 (230 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG20577.1| hypothetical protein MPH_02104 [Macrophomina phas... 74 6e-11 gb|KKY20972.1| putative betaine aldehyde dehydrogenase [Diplodia... 71 4e-10 ref|XP_007584536.1| putative betaine aldehyde dehydrogenase prot... 70 8e-10 >gb|EKG20577.1| hypothetical protein MPH_02104 [Macrophomina phaseolina MS6] Length = 500 Score = 73.6 bits (179), Expect = 6e-11 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = -3 Query: 114 ADLSYGTRQLFWDGKPQPASSGKTFQSINPATNQPIAT 1 +DL+YGTRQLFWDGKPQPASSG TFQSI+P+TN+PIAT Sbjct: 2 SDLAYGTRQLFWDGKPQPASSGHTFQSIDPSTNRPIAT 39 >gb|KKY20972.1| putative betaine aldehyde dehydrogenase [Diplodia seriata] Length = 497 Score = 70.9 bits (172), Expect = 4e-10 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -3 Query: 108 LSYGTRQLFWDGKPQPASSGKTFQSINPATNQPIAT 1 +SY TRQLFWDGKPQPASSG+TFQSI+P+TNQP+AT Sbjct: 1 MSYATRQLFWDGKPQPASSGQTFQSIDPSTNQPVAT 36 >ref|XP_007584536.1| putative betaine aldehyde dehydrogenase protein [Neofusicoccum parvum UCRNP2] gi|485922594|gb|EOD47997.1| putative betaine aldehyde dehydrogenase protein [Neofusicoccum parvum UCRNP2] Length = 499 Score = 69.7 bits (169), Expect = 8e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 108 LSYGTRQLFWDGKPQPASSGKTFQSINPATNQPIAT 1 L Y TRQLFWDGKPQPASSG+TFQSI+PATN+PIAT Sbjct: 4 LPYATRQLFWDGKPQPASSGQTFQSIDPATNRPIAT 39