BLASTX nr result
ID: Ziziphus21_contig00043221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00043221 (260 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFM38191.1| beta-1,3-glucan recognition protein 4a [Anasa tri... 59 2e-06 >gb|AFM38191.1| beta-1,3-glucan recognition protein 4a [Anasa tristis] Length = 480 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/81 (32%), Positives = 50/81 (61%), Gaps = 3/81 (3%) Frame = -1 Query: 236 PDYEFVTWERCLHVTYIRDGHVYLRPKIQPHEYTENS-VTLQTCTGKP--VKCTKKAVST 66 PDYEFV ++ +++RDGH+ ++P + + + L+ CT +P +C ++A + Sbjct: 183 PDYEFVVFDNNPQTSFVRDGHLTIKPTVYDDNFVRRGRLNLEGCTRRPHSDECFREAKTF 242 Query: 65 YTPPPIQASQIFTNNTFAFKY 3 PP+Q++++ T ++FAFKY Sbjct: 243 SILPPVQSARLTTKDSFAFKY 263