BLASTX nr result
ID: Ziziphus21_contig00042491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042491 (344 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG10258.1| hypothetical protein MPH_12640 [Macrophomina phas... 87 4e-15 ref|XP_007588417.1| hypothetical protein UCRNP2_9179 [Neofusicoc... 87 5e-15 gb|KKY22122.1| hypothetical protein UCDDS831_g03959 [Diplodia se... 84 5e-14 ref|XP_007925950.1| hypothetical protein MYCFIDRAFT_72218 [Pseud... 79 2e-12 gb|EME46663.1| hypothetical protein DOTSEDRAFT_70618 [Dothistrom... 77 4e-12 ref|XP_003844131.1| hypothetical protein LEMA_P017820.1 [Leptosp... 77 4e-12 ref|XP_014560566.1| hypothetical protein COCVIDRAFT_12616 [Bipol... 77 7e-12 ref|XP_007710144.1| hypothetical protein COCCADRAFT_90473 [Bipol... 77 7e-12 ref|XP_007703798.1| hypothetical protein COCSADRAFT_98913 [Bipol... 77 7e-12 gb|KJX98882.1| hypothetical protein TI39_contig385g00027 [Zymose... 76 9e-12 ref|XP_007783838.1| hypothetical protein W97_07779 [Coniosporium... 76 9e-12 ref|XP_007680306.1| hypothetical protein BAUCODRAFT_27656 [Baudo... 76 9e-12 ref|XP_003856120.1| hypothetical protein MYCGRDRAFT_32106 [Zymos... 76 9e-12 ref|XP_013323543.1| hypothetical protein T310_9452 [Rasamsonia e... 76 1e-11 ref|XP_014083301.1| hypothetical protein COCC4DRAFT_36940 [Bipol... 75 1e-11 ref|XP_007684045.1| hypothetical protein COCMIDRAFT_1798 [Bipola... 75 2e-11 gb|EMF13980.1| hypothetical protein SEPMUDRAFT_147852 [Sphaeruli... 75 2e-11 ref|XP_001802142.1| hypothetical protein SNOG_11907 [Parastagono... 75 2e-11 dbj|GAD97190.1| hypothetical protein NFIA_068540 [Byssochlamys s... 74 3e-11 ref|XP_003299693.1| hypothetical protein PTT_10744 [Pyrenophora ... 74 3e-11 >gb|EKG10258.1| hypothetical protein MPH_12640 [Macrophomina phaseolina MS6] Length = 108 Score = 87.4 bits (215), Expect = 4e-15 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITSQP 229 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS P Sbjct: 57 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITSPP 94 >ref|XP_007588417.1| hypothetical protein UCRNP2_9179 [Neofusicoccum parvum UCRNP2] gi|485916972|gb|EOD44117.1| hypothetical protein UCRNP2_9179 [Neofusicoccum parvum UCRNP2] Length = 108 Score = 87.0 bits (214), Expect = 5e-15 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITSQP 229 MVVVPYLGKYFGRKCAYWGWAK+MEWKYPVEV+ITSQP Sbjct: 57 MVVVPYLGKYFGRKCAYWGWAKYMEWKYPVEVQITSQP 94 >gb|KKY22122.1| hypothetical protein UCDDS831_g03959 [Diplodia seriata] Length = 108 Score = 83.6 bits (205), Expect = 5e-14 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEV+ITS Sbjct: 57 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVQITS 92 >ref|XP_007925950.1| hypothetical protein MYCFIDRAFT_72218 [Pseudocercospora fijiensis CIRAD86] gi|452983639|gb|EME83397.1| hypothetical protein MYCFIDRAFT_72218 [Pseudocercospora fijiensis CIRAD86] Length = 111 Score = 78.6 bits (192), Expect = 2e-12 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 +V++PYLGKYFGRKCAYWGWAKFMEWKYPV V+ITS Sbjct: 60 LVLIPYLGKYFGRKCAYWGWAKFMEWKYPVTVEITS 95 >gb|EME46663.1| hypothetical protein DOTSEDRAFT_70618 [Dothistroma septosporum NZE10] Length = 122 Score = 77.4 bits (189), Expect = 4e-12 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 +V++PYLGKYFGRKCAYWGW KFMEWKYPV V+ITS Sbjct: 71 LVLIPYLGKYFGRKCAYWGWGKFMEWKYPVSVEITS 106 >ref|XP_003844131.1| hypothetical protein LEMA_P017820.1 [Leptosphaeria maculans JN3] gi|312220711|emb|CBY00652.1| hypothetical protein LEMA_P017820.1 [Leptosphaeria maculans JN3] Length = 145 Score = 77.4 bits (189), Expect = 4e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 MVVVPYLGKYFGRKCAYWGWAK+M WKYPVEV I+S Sbjct: 94 MVVVPYLGKYFGRKCAYWGWAKYMTWKYPVEVVISS 129 >ref|XP_014560566.1| hypothetical protein COCVIDRAFT_12616 [Bipolaris victoriae FI3] gi|578493635|gb|EUN31026.1| hypothetical protein COCVIDRAFT_12616 [Bipolaris victoriae FI3] Length = 107 Score = 76.6 bits (187), Expect = 7e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 MV+VPYLGKYFGRK AYWGWAKFMEWKYPVEV I+S Sbjct: 56 MVMVPYLGKYFGRKAAYWGWAKFMEWKYPVEVTISS 91 >ref|XP_007710144.1| hypothetical protein COCCADRAFT_90473 [Bipolaris zeicola 26-R-13] gi|576921409|gb|EUC35550.1| hypothetical protein COCCADRAFT_90473 [Bipolaris zeicola 26-R-13] Length = 107 Score = 76.6 bits (187), Expect = 7e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 MV+VPYLGKYFGRK AYWGWAKFMEWKYPVEV I+S Sbjct: 56 MVMVPYLGKYFGRKAAYWGWAKFMEWKYPVEVTISS 91 >ref|XP_007703798.1| hypothetical protein COCSADRAFT_98913 [Bipolaris sorokiniana ND90Pr] gi|451847142|gb|EMD60450.1| hypothetical protein COCSADRAFT_98913 [Bipolaris sorokiniana ND90Pr] Length = 107 Score = 76.6 bits (187), Expect = 7e-12 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 MV+VPYLGKYFGRK AYWGWAKFMEWKYPVE+ I+S Sbjct: 56 MVMVPYLGKYFGRKAAYWGWAKFMEWKYPVEISISS 91 >gb|KJX98882.1| hypothetical protein TI39_contig385g00027 [Zymoseptoria brevis] Length = 110 Score = 76.3 bits (186), Expect = 9e-12 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 +V++PY+GKYFGRKCAYWGW KFMEWKYPV V+ITS Sbjct: 59 LVLIPYVGKYFGRKCAYWGWGKFMEWKYPVSVEITS 94 >ref|XP_007783838.1| hypothetical protein W97_07779 [Coniosporium apollinis CBS 100218] gi|494832207|gb|EON68521.1| hypothetical protein W97_07779 [Coniosporium apollinis CBS 100218] Length = 134 Score = 76.3 bits (186), Expect = 9e-12 Identities = 34/37 (91%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYP-VEVKITS 235 MVVVPYLGKYFGRKCAYWGWAKFMEWKYP VEV TS Sbjct: 82 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPDVEVVFTS 118 >ref|XP_007680306.1| hypothetical protein BAUCODRAFT_27656 [Baudoinia panamericana UAMH 10762] gi|449296338|gb|EMC92358.1| hypothetical protein BAUCODRAFT_27656 [Baudoinia panamericana UAMH 10762] Length = 594 Score = 76.3 bits (186), Expect = 9e-12 Identities = 28/36 (77%), Positives = 35/36 (97%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 MV+VPY+GKYFGRKCAYWGWAK+MEW+YPV +++TS Sbjct: 543 MVLVPYMGKYFGRKCAYWGWAKYMEWQYPVSIEVTS 578 >ref|XP_003856120.1| hypothetical protein MYCGRDRAFT_32106 [Zymoseptoria tritici IPO323] gi|339476005|gb|EGP91096.1| hypothetical protein MYCGRDRAFT_32106 [Zymoseptoria tritici IPO323] Length = 110 Score = 76.3 bits (186), Expect = 9e-12 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 +V++PY+GKYFGRKCAYWGW KFMEWKYPV V+ITS Sbjct: 59 LVLIPYVGKYFGRKCAYWGWGKFMEWKYPVSVEITS 94 >ref|XP_013323543.1| hypothetical protein T310_9452 [Rasamsonia emersonii CBS 393.64] gi|802086665|gb|KKA16931.1| hypothetical protein T310_9452 [Rasamsonia emersonii CBS 393.64] Length = 130 Score = 75.9 bits (185), Expect = 1e-11 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITSQ 232 MV+VP++GKYFGRKCAYWGW KFMEWKYP+EV +T++ Sbjct: 80 MVIVPFIGKYFGRKCAYWGWTKFMEWKYPIEVVMTNK 116 >ref|XP_014083301.1| hypothetical protein COCC4DRAFT_36940 [Bipolaris maydis ATCC 48331] gi|451997931|gb|EMD90396.1| hypothetical protein COCHEDRAFT_1215391 [Bipolaris maydis C5] gi|477592321|gb|ENI09392.1| hypothetical protein COCC4DRAFT_36940 [Bipolaris maydis ATCC 48331] Length = 107 Score = 75.5 bits (184), Expect = 1e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 MV+VPYLGKYFGRK AYWGWA+FMEWKYPVE+ I+S Sbjct: 56 MVMVPYLGKYFGRKAAYWGWARFMEWKYPVEISISS 91 >ref|XP_007684045.1| hypothetical protein COCMIDRAFT_1798 [Bipolaris oryzae ATCC 44560] gi|576935837|gb|EUC49337.1| hypothetical protein COCMIDRAFT_1798 [Bipolaris oryzae ATCC 44560] Length = 107 Score = 75.1 bits (183), Expect = 2e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 MV+VPYLGKYFGRK AYWGWAKFMEW+YPVEV I+S Sbjct: 56 MVMVPYLGKYFGRKAAYWGWAKFMEWQYPVEVTISS 91 >gb|EMF13980.1| hypothetical protein SEPMUDRAFT_147852 [Sphaerulina musiva SO2202] Length = 117 Score = 75.1 bits (183), Expect = 2e-11 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 +V++PYLGKYFGRKCAY+GWAKFMEWKYPV V+ITS Sbjct: 66 LVLIPYLGKYFGRKCAYYGWAKFMEWKYPVTVEITS 101 >ref|XP_001802142.1| hypothetical protein SNOG_11907 [Parastagonospora nodorum SN15] gi|111059831|gb|EAT80951.1| hypothetical protein SNOG_11907 [Parastagonospora nodorum SN15] Length = 111 Score = 74.7 bits (182), Expect = 2e-11 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 MV+VPYLGKYFGRKCAYWGWAK+MEW+YPVE+ I++ Sbjct: 60 MVLVPYLGKYFGRKCAYWGWAKWMEWQYPVEIVISN 95 >dbj|GAD97190.1| hypothetical protein NFIA_068540 [Byssochlamys spectabilis No. 5] Length = 126 Score = 74.3 bits (181), Expect = 3e-11 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITSQ 232 MV+VP++GKY GR+CAYWGW KFMEWKYPVEV +T+Q Sbjct: 75 MVLVPFIGKYMGRRCAYWGWTKFMEWKYPVEVVVTNQ 111 >ref|XP_003299693.1| hypothetical protein PTT_10744 [Pyrenophora teres f. teres 0-1] gi|311326518|gb|EFQ92205.1| hypothetical protein PTT_10744 [Pyrenophora teres f. teres 0-1] Length = 113 Score = 74.3 bits (181), Expect = 3e-11 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 342 MVVVPYLGKYFGRKCAYWGWAKFMEWKYPVEVKITS 235 MV+VPYLGKYFGRK AYWGWAKFMEWKYPVE+ +S Sbjct: 62 MVMVPYLGKYFGRKAAYWGWAKFMEWKYPVEIVFSS 97