BLASTX nr result
ID: Ziziphus21_contig00042462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042462 (278 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCI74358.1| unnamed protein product [Klebsiella pneumoniae s... 83 7e-14 gb|EDU61869.1| hypothetical protein PROSTU_00109 [Providencia st... 83 7e-14 gb|ABI99685.1| hypothetical protein APECO1_1785 [Escherichia col... 83 7e-14 gb|ABJ03470.1| conserved hypothetical protein [Escherichia coli ... 83 7e-14 dbj|GAL60547.1| hypothetical protein EV102420_46_00003 [Escheric... 82 1e-13 emb|CRH31471.1| Klebsiella pneumoniae subsp. rhinoscleromatis st... 79 1e-12 emb|CAJ55202.1| hypothetical protein LI1148 [Lawsonia intracellu... 71 3e-10 gb|KME19985.1| ribosome-dependent ATPase, partial [Klebsiella pn... 70 5e-10 emb|CBA31922.1| hypothetical protein Csp_D29540 [Curvibacter put... 66 9e-09 gb|AHJ14490.1| putative lipoprotein [Sulfurospirillum multivoran... 65 2e-08 gb|EDZ04993.1| lipoprotein, putative [Campylobacter jejuni subsp... 64 4e-08 pir||F81516 hypothetical protein CP0987 [imported] - Chlamydophi... 62 1e-07 emb|CRI38529.1| Uncharacterized protein BN1224_CV15_C_03620 [Chl... 62 1e-07 emb|CRI33410.1| Uncharacterized protein BN1224_Wien1_A_09170 [Ch... 62 1e-07 gb|ACO04175.1| conserved hypothetical protein [Persephonella mar... 60 2e-07 gb|EES92061.1| conserved hypothetical protein [Clostridium botul... 61 3e-07 gb|EES91647.1| conserved hypothetical protein [Clostridium botul... 61 3e-07 gb|ABK60662.1| conserved hypothetical protein [Clostridium novyi... 61 3e-07 gb|AHQ45531.1| hydrolase [Salmonella enterica subsp. enterica se... 61 4e-07 gb|AHU77307.1| hydrolase, partial [Salmonella enterica subsp. en... 61 4e-07 >emb|CCI74358.1| unnamed protein product [Klebsiella pneumoniae subsp. rhinoscleromatis SB3432] gi|499529229|emb|CCI75589.1| unnamed protein product [Klebsiella pneumoniae subsp. rhinoscleromatis SB3432] Length = 104 Score = 83.2 bits (204), Expect = 7e-14 Identities = 44/57 (77%), Positives = 46/57 (80%) Frame = -1 Query: 173 LHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 L SLPPILHIKAQ S+SSYSKGSRGLSVLPRV I T +SISL LG RQ H YAIR Sbjct: 10 LQSLPPILHIKAQCSVSSYSKGSRGLSVLPRVHCIFTASSISLSLGWRQPGHHYAIR 66 >gb|EDU61869.1| hypothetical protein PROSTU_00109 [Providencia stuartii ATCC 25827] Length = 189 Score = 83.2 bits (204), Expect = 7e-14 Identities = 44/57 (77%), Positives = 46/57 (80%) Frame = -1 Query: 173 LHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 L SLPPILHIKAQ S+SSYSKGSRGLSVLPRV I T +SISL LG RQ H YAIR Sbjct: 95 LQSLPPILHIKAQCSVSSYSKGSRGLSVLPRVHCIFTASSISLSLGWRQPGHHYAIR 151 >gb|ABI99685.1| hypothetical protein APECO1_1785 [Escherichia coli APEC O1] Length = 187 Score = 83.2 bits (204), Expect = 7e-14 Identities = 44/57 (77%), Positives = 46/57 (80%) Frame = -1 Query: 173 LHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 L SLPPILHIKAQ S+SSYSKGSRGLSVLPRV I T +SISL LG RQ H YAIR Sbjct: 98 LQSLPPILHIKAQCSVSSYSKGSRGLSVLPRVHCIFTASSISLSLGWRQPGHHYAIR 154 >gb|ABJ03470.1| conserved hypothetical protein [Escherichia coli APEC O1] Length = 217 Score = 83.2 bits (204), Expect = 7e-14 Identities = 44/57 (77%), Positives = 46/57 (80%) Frame = -1 Query: 173 LHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 L SLPPILHIKAQ S+SSYSKGSRGLSVLPRV I T +SISL LG RQ H YAIR Sbjct: 123 LQSLPPILHIKAQCSVSSYSKGSRGLSVLPRVHCIFTASSISLSLGWRQPGHHYAIR 179 >dbj|GAL60547.1| hypothetical protein EV102420_46_00003 [Escherichia vulneris NBRC 102420] Length = 104 Score = 82.4 bits (202), Expect = 1e-13 Identities = 44/57 (77%), Positives = 45/57 (78%) Frame = -1 Query: 173 LHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 L SLPPILHIKAQ S+SSYSKGSRGLSVLPRV I T SISL LG RQ H YAIR Sbjct: 10 LQSLPPILHIKAQCSVSSYSKGSRGLSVLPRVHCIFTAISISLSLGWRQPGHHYAIR 66 >emb|CRH31471.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812042466|emb|CRH31335.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812042628|emb|CRH31052.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812043303|emb|CRH30484.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812045581|emb|CRH28276.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812046120|emb|CRH27688.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812046418|emb|CRH27640.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812186768|emb|CRH40527.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812186930|emb|CRH40389.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812187076|emb|CRH40109.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812187820|emb|CRH39519.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812190655|emb|CRH36768.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812191060|emb|CRH35537.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812191361|emb|CRH35405.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812218112|emb|CRH37029.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812218322|emb|CRH36773.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812218624|emb|CRH36178.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812219184|emb|CRH34996.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812221773|emb|CRH32691.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812222149|emb|CRH32063.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] gi|812222524|emb|CRH32016.1| Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome {ECO:0000313|EMBL:CCI75589.1} [Pantoea ananatis] Length = 99 Score = 79.0 bits (193), Expect = 1e-12 Identities = 43/57 (75%), Positives = 44/57 (77%) Frame = -1 Query: 173 LHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 L SLPPILHIKAQ S+SS SKGSRGLSVLPRV I T SISL LG RQ H YAIR Sbjct: 5 LQSLPPILHIKAQCSVSSCSKGSRGLSVLPRVHCIFTAISISLSLGWRQPGHHYAIR 61 >emb|CAJ55202.1| hypothetical protein LI1148 [Lawsonia intracellularis PHE/MN1-00] Length = 99 Score = 71.2 bits (173), Expect = 3e-10 Identities = 37/58 (63%), Positives = 41/58 (70%) Frame = -1 Query: 176 RLHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 R H LPPILHI+AQ MSSYSKG++GL V R+ I T TSIS L RQC RYAIR Sbjct: 9 RFHWLPPILHIQAQNPMSSYSKGAQGLPVFLRIHGIFTATSISPSLWPRQCGDRYAIR 66 >gb|KME19985.1| ribosome-dependent ATPase, partial [Klebsiella pneumoniae] Length = 686 Score = 70.5 bits (171), Expect = 5e-10 Identities = 38/51 (74%), Positives = 40/51 (78%) Frame = -1 Query: 155 ILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 I HIKAQ S+SSYSKGSRGLSVLPRV I T +SISL LG RQ H YAIR Sbjct: 616 IEHIKAQCSVSSYSKGSRGLSVLPRVHCIFTASSISLSLGWRQPGHHYAIR 666 >emb|CBA31922.1| hypothetical protein Csp_D29540 [Curvibacter putative symbiont of Hydra magnipapillata] Length = 156 Score = 66.2 bits (160), Expect = 9e-09 Identities = 34/51 (66%), Positives = 36/51 (70%) Frame = -1 Query: 155 ILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 +LH Q + SYSKGS GLSV PR D IIT S SL LGRRQC HRYAIR Sbjct: 1 MLHRSVQSPIQSYSKGSWGLSVFPRGDCIITNISTSLSLGRRQCGHRYAIR 51 >gb|AHJ14490.1| putative lipoprotein [Sulfurospirillum multivorans DSM 12446] Length = 119 Score = 65.1 bits (157), Expect = 2e-08 Identities = 35/54 (64%), Positives = 39/54 (72%) Frame = -1 Query: 167 SLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAI 6 SLPPILHI ++SSYSKG RGLSVLPRV I T+T+ISL RQ RYAI Sbjct: 32 SLPPILHIFIPTAVSSYSKGPRGLSVLPRVGGIFTSTTISLDFWSRQLPSRYAI 85 >gb|EDZ04993.1| lipoprotein, putative [Campylobacter jejuni subsp. jejuni BH-01-0142] Length = 97 Score = 63.9 bits (154), Expect = 4e-08 Identities = 35/54 (64%), Positives = 39/54 (72%) Frame = -1 Query: 167 SLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAI 6 SLPPILHI Q ++SS SKG RGLSVLPRV I T+T+ISL RQ RYAI Sbjct: 12 SLPPILHILIQVAVSSCSKGPRGLSVLPRVGGIFTSTTISLDPSLRQLPSRYAI 65 >pir||F81516 hypothetical protein CP0987 [imported] - Chlamydophila pneumoniae (strain AR39) Length = 216 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/57 (59%), Positives = 38/57 (66%) Frame = -1 Query: 173 LHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 +HSL ILHI Q S+ YSKGSRGL VL RV+ I T T+IS L RQC RY IR Sbjct: 122 VHSLLAILHITNQKSIPKYSKGSRGLFVLLRVNSIFTATTISPSLSLRQCPDRYTIR 178 >emb|CRI38529.1| Uncharacterized protein BN1224_CV15_C_03620 [Chlamydia pneumoniae] gi|820673899|emb|CRI46388.1| Uncharacterized protein BN1224_MUL2216_F_04430 [Chlamydia pneumoniae] gi|820679562|emb|CRI52069.1| Uncharacterized protein BN1224_UZG1_B_02180 [Chlamydia pneumoniae] Length = 209 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/57 (59%), Positives = 38/57 (66%) Frame = -1 Query: 173 LHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 +HSL ILHI Q S+ YSKGSRGL VL RV+ I T T+IS L RQC RY IR Sbjct: 115 VHSLLAILHITNQKSIPKYSKGSRGLFVLLRVNSIFTATTISPSLSLRQCPDRYTIR 171 >emb|CRI33410.1| Uncharacterized protein BN1224_Wien1_A_09170 [Chlamydia pneumoniae] gi|820663355|emb|CRI36273.1| Uncharacterized protein BN1224_CM1_A_09200 [Chlamydia pneumoniae] gi|820664483|emb|CRI37400.1| Uncharacterized protein BN1224_CV14_A_09190 [Chlamydia pneumoniae] gi|820666748|emb|CRI39661.1| Uncharacterized protein BN1224_CWL011_A_09250 [Chlamydia pneumoniae] gi|820667885|emb|CRI40792.1| Uncharacterized protein CWL029c_F_00390 [Chlamydia pneumoniae] gi|820669015|emb|CRI41920.1| Uncharacterized protein BN1224_GiD_A_09210 [Chlamydia pneumoniae] gi|820670380|emb|CRI43015.1| Uncharacterized protein BN1224_DC9_CC_00160 [Chlamydia pneumoniae] gi|820671620|emb|CRI44132.1| Uncharacterized protein BN1224_H12_EY_00160 [Chlamydia pneumoniae] gi|820672761|emb|CRI45256.1| Uncharacterized protein BN1224_K7_A_09220 [Chlamydia pneumoniae] gi|820675038|emb|CRI47535.1| Uncharacterized protein BN1224_Panola_L_00390 [Chlamydia pneumoniae] gi|820676166|emb|CRI50940.1| Uncharacterized protein BN1224_PB1_B_09090 [Chlamydia pneumoniae] gi|820677296|emb|CRI48683.1| Uncharacterized protein BN1224_PB2_A_09240 [Chlamydia pneumoniae] gi|820678428|emb|CRI49812.1| Uncharacterized protein BN1224_U1271_C_07520 [Chlamydia pneumoniae] gi|820680700|emb|CRI53934.1| Uncharacterized protein BN1224_Wien2_H_01370 [Chlamydia pneumoniae] gi|820681832|emb|CRI54270.1| Uncharacterized protein BN1224_Wien3_A_09220 [Chlamydia pneumoniae] gi|821324158|emb|CRI73563.1| Uncharacterized protein BN1224_YK41_BY_00160 [Chlamydia pneumoniae] Length = 209 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/57 (59%), Positives = 38/57 (66%) Frame = -1 Query: 173 LHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 +HSL ILHI Q S+ YSKGSRGL VL RV+ I T T+IS L RQC RY IR Sbjct: 115 VHSLLAILHITNQKSIPKYSKGSRGLFVLLRVNSIFTATTISPSLSLRQCPDRYTIR 171 >gb|ACO04175.1| conserved hypothetical protein [Persephonella marina EX-H1] gi|225646335|gb|ACO04521.1| conserved hypothetical protein [Persephonella marina EX-H1] Length = 189 Score = 60.1 bits (144), Expect(2) = 2e-07 Identities = 33/56 (58%), Positives = 38/56 (67%) Frame = -1 Query: 173 LHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAI 6 L SLPPIL + + SM YSK SRGLSVLPRV I+T T+IS GL RQ R+ I Sbjct: 28 LPSLPPILRMTRKQSMPGYSKASRGLSVLPRVVGILTDTTISPGLSSRQRGDRWTI 83 Score = 21.9 bits (45), Expect(2) = 2e-07 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 223 GGVSGISPATQQGLLP 176 GG+S +P T +G LP Sbjct: 14 GGISPAAPGTPKGALP 29 >gb|EES92061.1| conserved hypothetical protein [Clostridium botulinum D str. 1873] Length = 210 Score = 61.2 bits (147), Expect = 3e-07 Identities = 35/57 (61%), Positives = 40/57 (70%) Frame = -1 Query: 173 LHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 L SLPPIL+ + + SM SYSK RGLSV PRV I T T+IS L RQCS+ YAIR Sbjct: 129 LLSLPPILYRQYRNSMLSYSKALRGLSVQPRVASIFTCTTISPDLLPRQCSNHYAIR 185 >gb|EES91647.1| conserved hypothetical protein [Clostridium botulinum D str. 1873] Length = 213 Score = 61.2 bits (147), Expect = 3e-07 Identities = 35/57 (61%), Positives = 40/57 (70%) Frame = -1 Query: 173 LHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 L SLPPIL+ + + SM SYSK RGLSV PRV I T T+IS L RQCS+ YAIR Sbjct: 129 LLSLPPILYRQYRNSMLSYSKALRGLSVQPRVASIFTCTTISPDLLPRQCSNHYAIR 185 >gb|ABK60662.1| conserved hypothetical protein [Clostridium novyi NT] gi|118133692|gb|ABK60736.1| conserved hypothetical protein [Clostridium novyi NT] gi|118133818|gb|ABK60862.1| conserved hypothetical protein [Clostridium novyi NT] gi|118133980|gb|ABK61024.1| conserved hypothetical protein [Clostridium novyi NT] gi|118134492|gb|ABK61536.1| conserved hypothetical protein [Clostridium novyi NT] gi|118135360|gb|ABK62404.1| conserved hypothetical protein [Clostridium novyi NT] gi|118135600|gb|ABK62644.1| conserved hypothetical protein [Clostridium novyi NT] gi|118135607|gb|ABK62651.1| conserved hypothetical protein [Clostridium novyi NT] Length = 213 Score = 61.2 bits (147), Expect = 3e-07 Identities = 35/57 (61%), Positives = 40/57 (70%) Frame = -1 Query: 173 LHSLPPILHIKAQYSMSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 L SLPPIL+ + + SM SYSK RGLSV PRV I T T+IS L RQCS+ YAIR Sbjct: 129 LLSLPPILYRQYRNSMLSYSKALRGLSVQPRVASIFTCTTISPDLLPRQCSNHYAIR 185 >gb|AHQ45531.1| hydrolase [Salmonella enterica subsp. enterica serovar Enteritidis str. SA20092320] Length = 75 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -1 Query: 128 MSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 MSSYSKGSRGLSVLPRV I T +SISL LG RQ H YAIR Sbjct: 1 MSSYSKGSRGLSVLPRVHCIFTASSISLSLGWRQPGHHYAIR 42 >gb|AHU77307.1| hydrolase, partial [Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121969] Length = 44 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -1 Query: 128 MSSYSKGSRGLSVLPRVDRIITTTSISLGLGRRQCSHRYAIR 3 MSSYSKGSRGLSVLPRV I T +SISL LG RQ H YAIR Sbjct: 1 MSSYSKGSRGLSVLPRVHCIFTASSISLSLGWRQPGHHYAIR 42