BLASTX nr result
ID: Ziziphus21_contig00042457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042457 (301 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG12765.1| protein of unknown function DUF250 [Macrophomina ... 73 7e-11 gb|KKY14149.1| putative solute carrier family 35 member e3 [Dipl... 69 1e-09 >gb|EKG12765.1| protein of unknown function DUF250 [Macrophomina phaseolina MS6] Length = 348 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 112 DEEKVPLNDDTSPVVSPADDEKTLPQWRPDRVVSPP 5 DEEKVPL+DD SP VSP DDEKTLPQWRPDRVVSPP Sbjct: 19 DEEKVPLHDDASPAVSPVDDEKTLPQWRPDRVVSPP 54 >gb|KKY14149.1| putative solute carrier family 35 member e3 [Diplodia seriata] Length = 352 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/44 (72%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = -1 Query: 127 AKPE--MDEEKVPLNDDTSPVVSPADDEKTLPQWRPDRVVSPPT 2 AKPE MDEEKVPL DD SP V+P ++EK LPQWRPDR VSPP+ Sbjct: 16 AKPEVAMDEEKVPLTDDASPAVTPIEEEKRLPQWRPDRPVSPPS 59