BLASTX nr result
ID: Ziziphus21_contig00042407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042407 (275 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFZ22992.1| hypothetical protein V502_02528, partial [Pseudog... 64 6e-08 gb|KFY92684.1| hypothetical protein V500_04070 [Pseudogymnoascus... 64 6e-08 >gb|KFZ22992.1| hypothetical protein V502_02528, partial [Pseudogymnoascus pannorum VKM F-4520 (FW-2644)] Length = 459 Score = 63.5 bits (153), Expect = 6e-08 Identities = 25/72 (34%), Positives = 48/72 (66%) Frame = +1 Query: 1 VCHPSELPSVGREMVADTRAYYRAEDVVDMNKRDIIELLAWTRRTAMKMLAAGLFLTLIT 180 + HPS LP R++ DT+ YY+ +D VD+ + +++++++++R+ A+KM A LFL L+ Sbjct: 20 ISHPSTLPQFFRDVFRDTKLYYQGQDTVDLERGELVKIISYSRKMAIKMSGASLFLGLLV 79 Query: 181 AMLVYSTCRDKQ 216 ++ + CR Q Sbjct: 80 SLSLIGQCRAAQ 91 >gb|KFY92684.1| hypothetical protein V500_04070 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] Length = 504 Score = 63.5 bits (153), Expect = 6e-08 Identities = 25/72 (34%), Positives = 48/72 (66%) Frame = +1 Query: 1 VCHPSELPSVGREMVADTRAYYRAEDVVDMNKRDIIELLAWTRRTAMKMLAAGLFLTLIT 180 + HPS LP R++ DT+ YY+ +D VD+ + +++++++++R+ A+KM A LFL L+ Sbjct: 20 ISHPSTLPQFFRDVFRDTKLYYQGQDTVDLERGELVKIISYSRKMAIKMSGASLFLGLLV 79 Query: 181 AMLVYSTCRDKQ 216 ++ + CR Q Sbjct: 80 SLSLIGQCRAAQ 91